Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4TCC2

Protein Details
Accession A0A4Q4TCC2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
205-232TYTPRMDPAPKGKRRKTHKDCPKAQGLAHydrophilic
NLS Segment(s)
PositionSequence
214-221PKGKRRKT
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MPASKPKLAQLTTPVTATFPSELSALSAKTPLSAVPDFIKEEFPSSEKTPITPPLAYMDFLRSMSVSSPVVPEKRSGSTTEEDSAHESVPSTASSEQTDRSCRCGSHKSPTSAPSSSPHPTQPMSAPPTGATSFPSLHLPPSPALSNLDSPLSATARSPFSARSVRSPFDWEAALKARYSQDCRASKSSGKSVRHIREVVTRTVTYTPRMDPAPKGKRRKTHKDCPKAQGLAAAVTRSNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.27
4 0.26
5 0.2
6 0.13
7 0.12
8 0.11
9 0.11
10 0.13
11 0.14
12 0.12
13 0.12
14 0.13
15 0.12
16 0.12
17 0.12
18 0.11
19 0.15
20 0.15
21 0.16
22 0.17
23 0.2
24 0.21
25 0.22
26 0.24
27 0.19
28 0.21
29 0.21
30 0.2
31 0.22
32 0.23
33 0.27
34 0.25
35 0.26
36 0.27
37 0.3
38 0.32
39 0.27
40 0.26
41 0.25
42 0.26
43 0.25
44 0.22
45 0.2
46 0.18
47 0.17
48 0.17
49 0.12
50 0.11
51 0.11
52 0.13
53 0.1
54 0.09
55 0.12
56 0.15
57 0.17
58 0.17
59 0.18
60 0.19
61 0.21
62 0.22
63 0.22
64 0.23
65 0.24
66 0.25
67 0.26
68 0.24
69 0.22
70 0.23
71 0.22
72 0.18
73 0.15
74 0.13
75 0.1
76 0.1
77 0.09
78 0.09
79 0.08
80 0.09
81 0.11
82 0.11
83 0.14
84 0.15
85 0.21
86 0.19
87 0.24
88 0.24
89 0.23
90 0.27
91 0.33
92 0.34
93 0.39
94 0.45
95 0.44
96 0.45
97 0.48
98 0.47
99 0.39
100 0.37
101 0.29
102 0.27
103 0.26
104 0.25
105 0.23
106 0.21
107 0.2
108 0.2
109 0.2
110 0.2
111 0.22
112 0.21
113 0.2
114 0.17
115 0.19
116 0.19
117 0.17
118 0.13
119 0.11
120 0.12
121 0.12
122 0.14
123 0.12
124 0.12
125 0.13
126 0.13
127 0.12
128 0.13
129 0.13
130 0.12
131 0.14
132 0.14
133 0.15
134 0.14
135 0.14
136 0.11
137 0.11
138 0.12
139 0.1
140 0.09
141 0.08
142 0.1
143 0.11
144 0.12
145 0.12
146 0.12
147 0.16
148 0.21
149 0.22
150 0.28
151 0.31
152 0.32
153 0.33
154 0.37
155 0.33
156 0.29
157 0.29
158 0.21
159 0.2
160 0.23
161 0.22
162 0.17
163 0.18
164 0.21
165 0.24
166 0.29
167 0.32
168 0.37
169 0.41
170 0.47
171 0.49
172 0.49
173 0.5
174 0.5
175 0.54
176 0.53
177 0.52
178 0.54
179 0.6
180 0.62
181 0.63
182 0.58
183 0.51
184 0.52
185 0.52
186 0.49
187 0.45
188 0.38
189 0.34
190 0.38
191 0.37
192 0.32
193 0.31
194 0.28
195 0.27
196 0.3
197 0.31
198 0.32
199 0.42
200 0.48
201 0.55
202 0.63
203 0.68
204 0.75
205 0.82
206 0.87
207 0.85
208 0.86
209 0.88
210 0.88
211 0.89
212 0.88
213 0.87
214 0.79
215 0.69
216 0.64
217 0.54
218 0.48
219 0.41
220 0.34
221 0.25