Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4ULK8

Protein Details
Accession A0A4Q4ULK8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-110ISTSYPKTRNEPKRATWFPRPRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MGGRKEGVTAGGTCQRAWTAGTGASPPRAFRERFLHMAPAYSGPYSVGFMDIELPVRQPRTFSNIKRNRAHALGLDTVLFSVFYPCDISTSYPKTRNEPKRATWFPRPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.19
4 0.19
5 0.17
6 0.12
7 0.13
8 0.14
9 0.15
10 0.16
11 0.2
12 0.2
13 0.18
14 0.22
15 0.25
16 0.25
17 0.27
18 0.33
19 0.34
20 0.37
21 0.38
22 0.38
23 0.33
24 0.33
25 0.29
26 0.24
27 0.2
28 0.16
29 0.14
30 0.1
31 0.1
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.07
38 0.07
39 0.08
40 0.07
41 0.08
42 0.08
43 0.1
44 0.1
45 0.1
46 0.11
47 0.16
48 0.23
49 0.27
50 0.37
51 0.45
52 0.53
53 0.56
54 0.58
55 0.55
56 0.5
57 0.47
58 0.38
59 0.33
60 0.27
61 0.23
62 0.19
63 0.15
64 0.14
65 0.12
66 0.1
67 0.06
68 0.06
69 0.05
70 0.06
71 0.08
72 0.08
73 0.09
74 0.1
75 0.14
76 0.19
77 0.27
78 0.33
79 0.38
80 0.41
81 0.47
82 0.57
83 0.64
84 0.67
85 0.68
86 0.7
87 0.74
88 0.8
89 0.81
90 0.81