Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4UNE0

Protein Details
Accession A0A4Q4UNE0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
282-301GTPPPPKSTQSRAKARPDTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR014710  RmlC-like_jellyroll  
Amino Acid Sequences MASKNALPAPRRIIASNLPLPRTKAAEPGVEPGVLMAVDVLEPEPILGGSLMRTRVATSKRVPTSNDGLNVPLDDVPGAGIVLPGGLNVYYLDLAPYTEGTMHRTTSTDYLVIVQGTLSLMTPPREPYTVKDGKATYGGPVETLCQPGEVVLQRGMMHAQIVAIGETCKAPTRRNHGGNRLSKQVWVPGWPPSHVLASKSPLQGGRRLGLGQARLASGPAATPNARAPSKADSGLSAPASSFTTAEPAAVNLCLWARRCLHVRSRYYFILGGRLDASLGVHGTPPPPKSTQSRAKARPDTPQAGRSHPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.47
4 0.46
5 0.45
6 0.45
7 0.47
8 0.45
9 0.44
10 0.37
11 0.36
12 0.34
13 0.37
14 0.36
15 0.37
16 0.35
17 0.3
18 0.28
19 0.21
20 0.18
21 0.12
22 0.1
23 0.06
24 0.04
25 0.04
26 0.04
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.04
35 0.04
36 0.06
37 0.1
38 0.11
39 0.11
40 0.12
41 0.13
42 0.2
43 0.23
44 0.28
45 0.3
46 0.39
47 0.44
48 0.46
49 0.48
50 0.47
51 0.49
52 0.48
53 0.45
54 0.37
55 0.32
56 0.3
57 0.27
58 0.22
59 0.17
60 0.12
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.07
87 0.11
88 0.12
89 0.13
90 0.13
91 0.14
92 0.15
93 0.15
94 0.16
95 0.12
96 0.11
97 0.12
98 0.12
99 0.11
100 0.09
101 0.07
102 0.06
103 0.06
104 0.06
105 0.04
106 0.04
107 0.06
108 0.07
109 0.08
110 0.1
111 0.12
112 0.13
113 0.14
114 0.17
115 0.25
116 0.29
117 0.28
118 0.31
119 0.29
120 0.29
121 0.3
122 0.27
123 0.18
124 0.15
125 0.14
126 0.1
127 0.1
128 0.11
129 0.1
130 0.11
131 0.09
132 0.08
133 0.08
134 0.07
135 0.1
136 0.09
137 0.09
138 0.08
139 0.09
140 0.09
141 0.1
142 0.1
143 0.07
144 0.07
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.09
156 0.1
157 0.14
158 0.19
159 0.27
160 0.36
161 0.44
162 0.5
163 0.55
164 0.63
165 0.66
166 0.64
167 0.62
168 0.53
169 0.47
170 0.41
171 0.37
172 0.29
173 0.24
174 0.22
175 0.22
176 0.24
177 0.22
178 0.24
179 0.2
180 0.23
181 0.21
182 0.22
183 0.18
184 0.2
185 0.25
186 0.23
187 0.24
188 0.24
189 0.25
190 0.27
191 0.27
192 0.25
193 0.21
194 0.21
195 0.21
196 0.2
197 0.2
198 0.16
199 0.15
200 0.14
201 0.13
202 0.13
203 0.11
204 0.08
205 0.07
206 0.07
207 0.09
208 0.09
209 0.1
210 0.13
211 0.19
212 0.19
213 0.19
214 0.21
215 0.23
216 0.26
217 0.26
218 0.24
219 0.19
220 0.21
221 0.24
222 0.22
223 0.17
224 0.13
225 0.13
226 0.14
227 0.13
228 0.12
229 0.08
230 0.11
231 0.1
232 0.11
233 0.1
234 0.09
235 0.1
236 0.09
237 0.09
238 0.07
239 0.08
240 0.11
241 0.13
242 0.17
243 0.19
244 0.24
245 0.29
246 0.35
247 0.43
248 0.5
249 0.55
250 0.56
251 0.6
252 0.57
253 0.55
254 0.51
255 0.42
256 0.41
257 0.33
258 0.29
259 0.24
260 0.22
261 0.19
262 0.16
263 0.15
264 0.09
265 0.09
266 0.08
267 0.08
268 0.09
269 0.12
270 0.17
271 0.19
272 0.22
273 0.24
274 0.29
275 0.35
276 0.44
277 0.51
278 0.56
279 0.65
280 0.69
281 0.77
282 0.82
283 0.78
284 0.79
285 0.77
286 0.76
287 0.71
288 0.7
289 0.63
290 0.61