Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4TJT5

Protein Details
Accession A0A4Q4TJT5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-73VQAPRQKRRPIREAESKKKAEBasic
NLS Segment(s)
PositionSequence
56-71PRQKRRPIREAESKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 12.833, mito_nucl 9.166, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MKHTICKYCDTLLVEGDTSTSFVENQSKGGKKPWADVLVVKCNTCGGLKRFPVQAPRQKRRPIREAESKKKAEDDAAAPAQVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.19
4 0.14
5 0.11
6 0.1
7 0.08
8 0.07
9 0.08
10 0.13
11 0.12
12 0.14
13 0.2
14 0.22
15 0.23
16 0.28
17 0.31
18 0.28
19 0.3
20 0.34
21 0.3
22 0.28
23 0.31
24 0.31
25 0.34
26 0.34
27 0.3
28 0.24
29 0.22
30 0.22
31 0.19
32 0.18
33 0.14
34 0.2
35 0.22
36 0.25
37 0.28
38 0.29
39 0.37
40 0.41
41 0.47
42 0.51
43 0.58
44 0.64
45 0.7
46 0.76
47 0.77
48 0.77
49 0.77
50 0.74
51 0.77
52 0.79
53 0.8
54 0.82
55 0.76
56 0.69
57 0.64
58 0.57
59 0.48
60 0.42
61 0.34
62 0.32
63 0.31