Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TJ01

Protein Details
Accession A0A4Q4TJ01   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
192-221LDAFFKNWPLKPKKRPRGPREKARYLTKLMHydrophilic
NLS Segment(s)
PositionSequence
201-215LKPKKRPRGPREKAR
Subcellular Location(s) cyto_nucl 9, nucl 8, cyto 8, extr 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020472  G-protein_beta_WD-40_rep  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR019775  WD40_repeat_CS  
IPR036322  WD40_repeat_dom_sf  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS00678  WD_REPEATS_1  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
CDD cd00200  WD40  
Amino Acid Sequences MGRGNGRIWDAATGAYLSTLAGYGDQVRSIAFSRDGSRLASGFYDSTVKIWDAATGAYLSTFAGYGGSVNSVAFSRDGSRLASGSGDSTVKVWDAATGACLLTLEGHGHGGPVTSVAFSRDGSRLASGSGDRTVKMWDAATGACLLTLEGHGHGGPVTSVAFSRDGSRLASGSYDCTVKVWDAATGACLSTLDAFFKNWPLKPKKRPRGPREKARYLTKLMGNPVTFKDYIGVTGFYEDICTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.06
5 0.06
6 0.06
7 0.05
8 0.05
9 0.06
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.11
16 0.12
17 0.14
18 0.13
19 0.15
20 0.18
21 0.21
22 0.22
23 0.22
24 0.22
25 0.19
26 0.19
27 0.17
28 0.15
29 0.13
30 0.13
31 0.14
32 0.12
33 0.12
34 0.13
35 0.13
36 0.12
37 0.12
38 0.11
39 0.09
40 0.09
41 0.09
42 0.08
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.09
63 0.1
64 0.11
65 0.11
66 0.12
67 0.12
68 0.12
69 0.11
70 0.09
71 0.08
72 0.09
73 0.08
74 0.07
75 0.08
76 0.08
77 0.07
78 0.07
79 0.06
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.04
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.08
107 0.09
108 0.1
109 0.1
110 0.11
111 0.1
112 0.1
113 0.11
114 0.09
115 0.09
116 0.11
117 0.11
118 0.1
119 0.1
120 0.11
121 0.1
122 0.11
123 0.1
124 0.07
125 0.08
126 0.08
127 0.08
128 0.07
129 0.07
130 0.06
131 0.05
132 0.05
133 0.04
134 0.05
135 0.05
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.06
150 0.08
151 0.09
152 0.1
153 0.1
154 0.11
155 0.11
156 0.1
157 0.11
158 0.1
159 0.11
160 0.11
161 0.11
162 0.1
163 0.1
164 0.11
165 0.1
166 0.11
167 0.09
168 0.08
169 0.09
170 0.09
171 0.09
172 0.09
173 0.08
174 0.07
175 0.07
176 0.06
177 0.07
178 0.08
179 0.09
180 0.09
181 0.1
182 0.11
183 0.18
184 0.22
185 0.24
186 0.34
187 0.42
188 0.51
189 0.61
190 0.72
191 0.76
192 0.82
193 0.9
194 0.91
195 0.93
196 0.93
197 0.93
198 0.92
199 0.92
200 0.89
201 0.87
202 0.82
203 0.76
204 0.72
205 0.67
206 0.61
207 0.56
208 0.55
209 0.47
210 0.44
211 0.41
212 0.39
213 0.33
214 0.29
215 0.26
216 0.2
217 0.21
218 0.2
219 0.18
220 0.13
221 0.15
222 0.15
223 0.13
224 0.15