Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TK78

Protein Details
Accession A0A4Q4TK78   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
270-295AHGEERFHPKPRKKRRPLGWAMRVLHBasic
NLS Segment(s)
PositionSequence
277-286HPKPRKKRRP
Subcellular Location(s) plas 11, extr 9, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001204  Phos_transporter  
Gene Ontology GO:0016020  C:membrane  
GO:0005315  F:inorganic phosphate transmembrane transporter activity  
GO:0015293  F:symporter activity  
GO:0006817  P:phosphate ion transport  
Pfam View protein in Pfam  
PF01384  PHO4  
Amino Acid Sequences MTKIHEYNYVFVIGIFFAMLYAYNNGASNGIRYHIRDAWGDTRRRADGRDDQERVVPNAAFQENPGVQMLAFTCALAAASSWVMWCTRNSTHVSPTYSLISAVAGVGIATAGAWQGPRLSSSSSPGTACTLSIVCKGSPNLGLNKKPSWYIAAVNMGTGCGVPVLSAIFFVPFLARGSSRRKDYTVKWYMFVMGSLSFSRETPADPDHAQNKVPNYAVVQHDDLPELTATTMSLDENESGVTPILAPSREKATELAVAEFTQLNYKALVAHGEERFHPKPRKKRRPLGWAMRVLHDNPMGAGQVYELRNVRILARHIRRHGSRRCTLRPALRYPHDAGGYRGHARWLAHASGAYAHAEKYPTEIEHTSSFVQILTACTASFAHGADNIGNSAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.06
4 0.05
5 0.05
6 0.05
7 0.06
8 0.08
9 0.08
10 0.1
11 0.1
12 0.11
13 0.12
14 0.12
15 0.13
16 0.12
17 0.14
18 0.16
19 0.18
20 0.23
21 0.25
22 0.27
23 0.27
24 0.32
25 0.39
26 0.44
27 0.47
28 0.45
29 0.48
30 0.5
31 0.5
32 0.47
33 0.46
34 0.47
35 0.51
36 0.57
37 0.55
38 0.51
39 0.54
40 0.55
41 0.49
42 0.43
43 0.34
44 0.25
45 0.27
46 0.27
47 0.22
48 0.19
49 0.24
50 0.2
51 0.21
52 0.21
53 0.15
54 0.14
55 0.16
56 0.16
57 0.11
58 0.11
59 0.09
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.09
73 0.13
74 0.15
75 0.19
76 0.25
77 0.27
78 0.33
79 0.37
80 0.4
81 0.36
82 0.36
83 0.34
84 0.29
85 0.26
86 0.2
87 0.14
88 0.11
89 0.09
90 0.07
91 0.04
92 0.03
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.02
99 0.03
100 0.03
101 0.03
102 0.05
103 0.05
104 0.06
105 0.08
106 0.11
107 0.11
108 0.16
109 0.18
110 0.19
111 0.19
112 0.19
113 0.2
114 0.17
115 0.16
116 0.13
117 0.11
118 0.11
119 0.13
120 0.14
121 0.12
122 0.15
123 0.15
124 0.15
125 0.18
126 0.2
127 0.25
128 0.29
129 0.32
130 0.34
131 0.35
132 0.34
133 0.32
134 0.3
135 0.25
136 0.21
137 0.19
138 0.18
139 0.21
140 0.2
141 0.19
142 0.18
143 0.14
144 0.13
145 0.11
146 0.07
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.05
161 0.06
162 0.07
163 0.11
164 0.18
165 0.23
166 0.27
167 0.28
168 0.3
169 0.34
170 0.37
171 0.44
172 0.46
173 0.42
174 0.39
175 0.38
176 0.36
177 0.31
178 0.27
179 0.17
180 0.08
181 0.09
182 0.08
183 0.09
184 0.08
185 0.08
186 0.08
187 0.08
188 0.08
189 0.09
190 0.1
191 0.12
192 0.12
193 0.16
194 0.18
195 0.19
196 0.19
197 0.19
198 0.2
199 0.19
200 0.18
201 0.16
202 0.14
203 0.17
204 0.17
205 0.18
206 0.17
207 0.16
208 0.17
209 0.17
210 0.16
211 0.12
212 0.11
213 0.08
214 0.07
215 0.05
216 0.05
217 0.05
218 0.05
219 0.04
220 0.05
221 0.05
222 0.06
223 0.06
224 0.06
225 0.06
226 0.06
227 0.06
228 0.05
229 0.05
230 0.05
231 0.07
232 0.08
233 0.08
234 0.09
235 0.13
236 0.14
237 0.15
238 0.14
239 0.15
240 0.18
241 0.18
242 0.18
243 0.14
244 0.14
245 0.14
246 0.14
247 0.12
248 0.11
249 0.11
250 0.1
251 0.1
252 0.1
253 0.09
254 0.09
255 0.11
256 0.09
257 0.14
258 0.15
259 0.16
260 0.18
261 0.25
262 0.28
263 0.35
264 0.42
265 0.46
266 0.55
267 0.66
268 0.76
269 0.79
270 0.86
271 0.88
272 0.9
273 0.91
274 0.92
275 0.89
276 0.86
277 0.78
278 0.71
279 0.64
280 0.53
281 0.47
282 0.37
283 0.27
284 0.19
285 0.17
286 0.14
287 0.12
288 0.1
289 0.07
290 0.12
291 0.12
292 0.16
293 0.16
294 0.16
295 0.18
296 0.19
297 0.2
298 0.18
299 0.23
300 0.3
301 0.38
302 0.45
303 0.48
304 0.56
305 0.62
306 0.67
307 0.72
308 0.71
309 0.7
310 0.72
311 0.74
312 0.73
313 0.73
314 0.73
315 0.71
316 0.7
317 0.72
318 0.68
319 0.66
320 0.62
321 0.6
322 0.55
323 0.48
324 0.42
325 0.4
326 0.39
327 0.37
328 0.33
329 0.29
330 0.28
331 0.28
332 0.3
333 0.29
334 0.25
335 0.23
336 0.23
337 0.22
338 0.21
339 0.21
340 0.18
341 0.14
342 0.14
343 0.15
344 0.16
345 0.15
346 0.17
347 0.18
348 0.17
349 0.22
350 0.23
351 0.24
352 0.25
353 0.28
354 0.26
355 0.23
356 0.22
357 0.17
358 0.17
359 0.14
360 0.14
361 0.14
362 0.13
363 0.12
364 0.13
365 0.13
366 0.14
367 0.14
368 0.12
369 0.11
370 0.12
371 0.14
372 0.14
373 0.15
374 0.14