Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UX71

Protein Details
Accession A0A4Q4UX71    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-45AGKVKSQTPKVEKKEKPKTPKGRAKKRLTYTRRFVBasic
NLS Segment(s)
PositionSequence
11-37AGKVKSQTPKVEKKEKPKTPKGRAKKR
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKKEKPKTPKGRAKKRLTYTRRFVNVTLTGGKRKTRQTARSLLSSRSHDREDLEGDGRAKNANSVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.52
5 0.57
6 0.67
7 0.69
8 0.75
9 0.75
10 0.78
11 0.8
12 0.81
13 0.82
14 0.83
15 0.86
16 0.86
17 0.89
18 0.89
19 0.9
20 0.9
21 0.9
22 0.89
23 0.87
24 0.87
25 0.84
26 0.82
27 0.77
28 0.75
29 0.69
30 0.61
31 0.52
32 0.47
33 0.41
34 0.34
35 0.32
36 0.26
37 0.25
38 0.26
39 0.29
40 0.28
41 0.31
42 0.38
43 0.43
44 0.48
45 0.52
46 0.58
47 0.59
48 0.62
49 0.6
50 0.55
51 0.52
52 0.51
53 0.49
54 0.45
55 0.43
56 0.36
57 0.36
58 0.34
59 0.32
60 0.3
61 0.27
62 0.26
63 0.25
64 0.25
65 0.24
66 0.22
67 0.19
68 0.18