Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4U5E8

Protein Details
Accession A0A4Q4U5E8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
117-136LATPKAPPLHRKKKRGSVSSHydrophilic
NLS Segment(s)
PositionSequence
121-131KAPPLHRKKKR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
CDD cd00024  CD_CSD  
Amino Acid Sequences MGARSTTSGITKPSARNRKRAQGSSYGRRSSLRLAIRESLRDAPPAAPVLASVPDSVVPHTPLAFTPPGSAPRPSSQHSTSTSASTTGTTGSSTLSAPTSLASSPSSTACASPPGPLATPKAPPLHRKKKRGSVSSGVVDESHGILPTPRKGWHSVKEIVGEGRDRGNLVYLIEWEGCDPKSGIMWPCSWVDAGDVSAGAIHEWETRKGTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.64
4 0.7
5 0.76
6 0.8
7 0.79
8 0.74
9 0.74
10 0.78
11 0.78
12 0.78
13 0.7
14 0.62
15 0.57
16 0.53
17 0.48
18 0.47
19 0.43
20 0.38
21 0.39
22 0.44
23 0.45
24 0.45
25 0.43
26 0.4
27 0.35
28 0.33
29 0.3
30 0.24
31 0.23
32 0.23
33 0.19
34 0.13
35 0.12
36 0.12
37 0.12
38 0.11
39 0.09
40 0.08
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.11
49 0.1
50 0.14
51 0.13
52 0.12
53 0.13
54 0.15
55 0.19
56 0.2
57 0.22
58 0.21
59 0.25
60 0.29
61 0.29
62 0.33
63 0.31
64 0.33
65 0.35
66 0.37
67 0.33
68 0.3
69 0.28
70 0.23
71 0.21
72 0.17
73 0.13
74 0.09
75 0.08
76 0.07
77 0.07
78 0.06
79 0.07
80 0.06
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.09
94 0.09
95 0.09
96 0.08
97 0.11
98 0.1
99 0.1
100 0.11
101 0.11
102 0.11
103 0.12
104 0.15
105 0.14
106 0.16
107 0.18
108 0.22
109 0.24
110 0.32
111 0.42
112 0.5
113 0.57
114 0.65
115 0.7
116 0.74
117 0.8
118 0.79
119 0.75
120 0.7
121 0.67
122 0.61
123 0.54
124 0.44
125 0.35
126 0.28
127 0.22
128 0.16
129 0.11
130 0.07
131 0.06
132 0.08
133 0.11
134 0.14
135 0.16
136 0.17
137 0.19
138 0.26
139 0.32
140 0.38
141 0.41
142 0.43
143 0.43
144 0.43
145 0.42
146 0.37
147 0.32
148 0.26
149 0.21
150 0.18
151 0.16
152 0.15
153 0.13
154 0.14
155 0.12
156 0.12
157 0.11
158 0.1
159 0.12
160 0.12
161 0.12
162 0.11
163 0.12
164 0.12
165 0.13
166 0.12
167 0.1
168 0.12
169 0.16
170 0.19
171 0.19
172 0.2
173 0.21
174 0.22
175 0.22
176 0.21
177 0.17
178 0.15
179 0.13
180 0.12
181 0.1
182 0.09
183 0.08
184 0.08
185 0.08
186 0.07
187 0.06
188 0.06
189 0.11
190 0.13
191 0.17
192 0.19