Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T505

Protein Details
Accession A0A4Q4T505   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-98HARTPARTSGKRKRRRRSRKKGKKKETTTTPSSRBasic
103-133GAPPPRPRSRHSRPRRASRAAAAPRRPRRGGBasic
NLS Segment(s)
PositionSequence
70-133ARTSGKRKRRRRSRKKGKKKETTTTPSSRAPADGAPPPRPRSRHSRPRRASRAAAAPRRPRRGG
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018860  APC_suCDC26  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
Pfam View protein in Pfam  
PF10471  ANAPC_CDC26  
Amino Acid Sequences MLRRPPTTLTLTAEDIASYEDRRAAALAAASQSQQSSSSPLLLAHQHQHQHGDSNNNNSSLLNAHARTPARTSGKRKRRRRSRKKGKKKETTTTPSSRAPADGAPPPRPRSRHSRPRRASRAAAAPRRPRRGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.18
4 0.15
5 0.12
6 0.1
7 0.11
8 0.11
9 0.12
10 0.12
11 0.1
12 0.1
13 0.1
14 0.1
15 0.09
16 0.1
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.08
23 0.11
24 0.11
25 0.11
26 0.11
27 0.12
28 0.13
29 0.14
30 0.16
31 0.16
32 0.19
33 0.21
34 0.21
35 0.24
36 0.22
37 0.24
38 0.24
39 0.28
40 0.27
41 0.31
42 0.32
43 0.29
44 0.29
45 0.25
46 0.24
47 0.17
48 0.16
49 0.12
50 0.11
51 0.11
52 0.15
53 0.16
54 0.16
55 0.17
56 0.21
57 0.24
58 0.3
59 0.38
60 0.45
61 0.55
62 0.65
63 0.73
64 0.78
65 0.84
66 0.89
67 0.92
68 0.93
69 0.94
70 0.96
71 0.97
72 0.97
73 0.97
74 0.96
75 0.93
76 0.92
77 0.9
78 0.86
79 0.83
80 0.78
81 0.72
82 0.64
83 0.57
84 0.48
85 0.38
86 0.33
87 0.26
88 0.23
89 0.25
90 0.27
91 0.32
92 0.38
93 0.42
94 0.47
95 0.48
96 0.49
97 0.53
98 0.59
99 0.63
100 0.68
101 0.74
102 0.78
103 0.86
104 0.91
105 0.88
106 0.84
107 0.8
108 0.8
109 0.79
110 0.78
111 0.77
112 0.78
113 0.8