Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L762

Protein Details
Accession A0A4Q9L762   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-86IEEERKWLKKWKKTYKNRKNILTHNIINHydrophilic
NLS Segment(s)
PositionSequence
67-71KKWKK
Subcellular Location(s) nucl 23.5, mito_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGVIMRAKMHEELKPYLKEEKREEDGLKNFKLKNKAPFIPQGRTTLEEPTNNINKESDIEEERKWLKKWKKTYKNRKNILTHNIINDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.43
4 0.44
5 0.48
6 0.49
7 0.51
8 0.49
9 0.51
10 0.51
11 0.49
12 0.53
13 0.51
14 0.48
15 0.46
16 0.43
17 0.43
18 0.48
19 0.45
20 0.46
21 0.48
22 0.48
23 0.46
24 0.52
25 0.52
26 0.49
27 0.47
28 0.42
29 0.36
30 0.36
31 0.33
32 0.29
33 0.26
34 0.22
35 0.22
36 0.24
37 0.28
38 0.26
39 0.26
40 0.22
41 0.2
42 0.2
43 0.2
44 0.18
45 0.16
46 0.18
47 0.18
48 0.23
49 0.26
50 0.3
51 0.3
52 0.37
53 0.43
54 0.49
55 0.6
56 0.66
57 0.73
58 0.8
59 0.9
60 0.91
61 0.93
62 0.93
63 0.91
64 0.89
65 0.87
66 0.85
67 0.82
68 0.75