Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L3N1

Protein Details
Accession A0A4Q9L3N1    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21GTRILPRKTRKGIRKVACIGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
Amino Acid Sequences GTRILPRKTRKGIRKVACIGAWHPAGVLSTVPRAGQMGFHRRTMTNLQVYMIGNGHKEFNTEYDLTVKGINPMGGFPHYGNINNDFVMVKGSIMGPRKRVVVLRKSLSKEKPKLENVILKFVDTSSKIGHGRFQTSGEKKEFYGILKKDVKAGGNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.77
4 0.69
5 0.62
6 0.52
7 0.49
8 0.4
9 0.3
10 0.25
11 0.19
12 0.17
13 0.14
14 0.14
15 0.08
16 0.09
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.14
23 0.19
24 0.27
25 0.29
26 0.31
27 0.34
28 0.33
29 0.37
30 0.37
31 0.37
32 0.31
33 0.3
34 0.28
35 0.28
36 0.28
37 0.25
38 0.21
39 0.15
40 0.12
41 0.12
42 0.13
43 0.1
44 0.1
45 0.1
46 0.1
47 0.13
48 0.12
49 0.12
50 0.13
51 0.14
52 0.13
53 0.14
54 0.12
55 0.1
56 0.1
57 0.1
58 0.08
59 0.08
60 0.08
61 0.08
62 0.09
63 0.07
64 0.08
65 0.09
66 0.1
67 0.11
68 0.12
69 0.13
70 0.12
71 0.12
72 0.1
73 0.1
74 0.1
75 0.09
76 0.06
77 0.06
78 0.06
79 0.09
80 0.15
81 0.16
82 0.17
83 0.19
84 0.2
85 0.21
86 0.25
87 0.29
88 0.32
89 0.38
90 0.42
91 0.47
92 0.5
93 0.57
94 0.6
95 0.63
96 0.62
97 0.61
98 0.64
99 0.62
100 0.63
101 0.61
102 0.6
103 0.53
104 0.54
105 0.47
106 0.39
107 0.35
108 0.3
109 0.28
110 0.21
111 0.21
112 0.14
113 0.19
114 0.21
115 0.21
116 0.27
117 0.27
118 0.29
119 0.29
120 0.31
121 0.36
122 0.39
123 0.45
124 0.43
125 0.42
126 0.38
127 0.41
128 0.39
129 0.33
130 0.37
131 0.33
132 0.38
133 0.43
134 0.43
135 0.44
136 0.46