Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LKY6

Protein Details
Accession A0A4Q9LKY6   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
73-101QVGCFRCCWSKKKKPSKTKNKYKELDQGSHydrophilic
NLS Segment(s)
PositionSequence
83-92KKKKPSKTKN
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKNNSLFLKDLVKKKKNIDAFSVKSHVEVLFNETYSGKEQQKAAKSENPYIKEDITDSKKYLGNKDTESEDEQVGCFRCCWSKKKKPSKTKNKYKELDQGSFQTYRRASSFDDIDYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.67
4 0.64
5 0.63
6 0.62
7 0.6
8 0.59
9 0.57
10 0.48
11 0.4
12 0.38
13 0.3
14 0.22
15 0.18
16 0.18
17 0.16
18 0.16
19 0.16
20 0.15
21 0.16
22 0.17
23 0.22
24 0.18
25 0.19
26 0.22
27 0.27
28 0.33
29 0.35
30 0.36
31 0.37
32 0.39
33 0.44
34 0.47
35 0.45
36 0.41
37 0.39
38 0.35
39 0.29
40 0.27
41 0.25
42 0.25
43 0.23
44 0.21
45 0.22
46 0.24
47 0.25
48 0.28
49 0.26
50 0.24
51 0.23
52 0.25
53 0.24
54 0.24
55 0.25
56 0.23
57 0.19
58 0.16
59 0.15
60 0.15
61 0.14
62 0.13
63 0.1
64 0.1
65 0.16
66 0.2
67 0.28
68 0.36
69 0.46
70 0.56
71 0.67
72 0.77
73 0.82
74 0.89
75 0.93
76 0.94
77 0.95
78 0.95
79 0.94
80 0.88
81 0.84
82 0.82
83 0.78
84 0.71
85 0.64
86 0.57
87 0.51
88 0.5
89 0.43
90 0.41
91 0.34
92 0.33
93 0.31
94 0.3
95 0.29
96 0.31
97 0.34