Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9L1J7

Protein Details
Accession A0A4Q9L1J7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-90IETARKYDEKKMKKMNPKIVRRIFYGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVCCKSVIMNQNNQAMIVKNLVDSLKNMPSREMLGSYTITRLDDLIYSPNTIDGINKNDFVTKTIETARKYDEKKMKKMNPKIVRRIFYGLEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.33
3 0.28
4 0.21
5 0.16
6 0.11
7 0.13
8 0.13
9 0.12
10 0.12
11 0.15
12 0.2
13 0.23
14 0.23
15 0.22
16 0.23
17 0.25
18 0.24
19 0.21
20 0.15
21 0.14
22 0.15
23 0.14
24 0.14
25 0.12
26 0.11
27 0.1
28 0.09
29 0.08
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.13
42 0.14
43 0.15
44 0.15
45 0.17
46 0.17
47 0.18
48 0.19
49 0.15
50 0.16
51 0.21
52 0.26
53 0.25
54 0.27
55 0.31
56 0.35
57 0.37
58 0.44
59 0.49
60 0.52
61 0.6
62 0.68
63 0.73
64 0.76
65 0.83
66 0.85
67 0.85
68 0.87
69 0.88
70 0.87
71 0.81
72 0.75
73 0.7