Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KXM3

Protein Details
Accession A0A4Q9KXM3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
109-129RNQKCGHCADLRPKKKRKDKKBasic
NLS Segment(s)
PositionSequence
120-129RPKKKRKDKK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MQVFVKCLGQNTITVDIPCKSSSDELKGILQEKTGIVSKDQLLFYCNRPLNGCSLEEMGITSLSTISMTQKLLGGVLSENTRALAMSYQNIKICRKCYCRNGANATHCRNQKCGHCADLRPKKKRKDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.23
5 0.21
6 0.18
7 0.16
8 0.19
9 0.23
10 0.26
11 0.27
12 0.27
13 0.28
14 0.3
15 0.3
16 0.26
17 0.22
18 0.17
19 0.15
20 0.16
21 0.16
22 0.14
23 0.13
24 0.15
25 0.17
26 0.2
27 0.2
28 0.18
29 0.17
30 0.18
31 0.2
32 0.26
33 0.25
34 0.22
35 0.23
36 0.24
37 0.26
38 0.25
39 0.23
40 0.16
41 0.16
42 0.15
43 0.13
44 0.12
45 0.09
46 0.07
47 0.06
48 0.05
49 0.04
50 0.03
51 0.04
52 0.04
53 0.05
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.06
70 0.06
71 0.07
72 0.07
73 0.1
74 0.13
75 0.16
76 0.18
77 0.22
78 0.25
79 0.28
80 0.31
81 0.36
82 0.41
83 0.47
84 0.53
85 0.6
86 0.62
87 0.66
88 0.7
89 0.7
90 0.71
91 0.72
92 0.69
93 0.67
94 0.66
95 0.61
96 0.57
97 0.55
98 0.53
99 0.51
100 0.49
101 0.48
102 0.49
103 0.53
104 0.6
105 0.65
106 0.68
107 0.72
108 0.77
109 0.81