Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KXK8

Protein Details
Accession A0A4Q9KXK8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
57-76EIKIIKKKFKLRNTAYMQEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MDEVWIKIGNITSLTVEQLQKMFLWMYAEGKKPSFVTSLNKQKLKSTNLFFIDEKIEIKIIKKKFKLRNTAYMQEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.15
4 0.15
5 0.14
6 0.14
7 0.12
8 0.13
9 0.12
10 0.09
11 0.11
12 0.1
13 0.13
14 0.16
15 0.2
16 0.2
17 0.2
18 0.2
19 0.19
20 0.2
21 0.17
22 0.16
23 0.18
24 0.25
25 0.35
26 0.41
27 0.43
28 0.42
29 0.46
30 0.5
31 0.5
32 0.48
33 0.42
34 0.42
35 0.42
36 0.45
37 0.4
38 0.36
39 0.32
40 0.26
41 0.23
42 0.17
43 0.16
44 0.13
45 0.17
46 0.23
47 0.28
48 0.36
49 0.43
50 0.52
51 0.6
52 0.69
53 0.76
54 0.76
55 0.79
56 0.79