Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L843

Protein Details
Accession A0A4Q9L843   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-101AGTVSKFKRKIKRIMKNFNFPVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 4, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR006549  HAD-SF_hydro_IIIA  
IPR023214  HAD_sf  
IPR013954  PNK3P  
IPR006551  Polynucleotide_phosphatase  
Gene Ontology GO:0016301  F:kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF08645  PNK3P  
Amino Acid Sequences MILDNLLIVKNYDKDFKKYVKIAAFDLDNTIINNLPNRAAEDERGWVFRYKNVISKMNNLHTEGYLVAILSNQSGLILAGTVSKFKRKIKRIMKNFNFPVIFIAALYKDFYRKPSIGMFNFLVEYHILDGNIDHKNSFYVGDAAGRSHLPFNDHSDCDIKFAYNANIEFYTPEEFFDEQPKSHKNIEFFKIDSYRNEISFDTKNFINFDIVFVYGNAVKYCGKTHFSKKYFQNFSILRNPQGISKTHEKIIFFDVYDENLIKKIIRNRKIQNIGVFHLSYDKKVLKYLKRLGELSGKKSESLIENCNENFSSFFDIPIISVPFIFDDTDFSPELRKISQLQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.47
4 0.53
5 0.53
6 0.58
7 0.57
8 0.55
9 0.52
10 0.49
11 0.44
12 0.36
13 0.34
14 0.28
15 0.22
16 0.19
17 0.18
18 0.15
19 0.14
20 0.17
21 0.15
22 0.16
23 0.16
24 0.18
25 0.21
26 0.22
27 0.23
28 0.22
29 0.26
30 0.26
31 0.27
32 0.27
33 0.27
34 0.26
35 0.27
36 0.32
37 0.3
38 0.35
39 0.39
40 0.44
41 0.43
42 0.51
43 0.55
44 0.55
45 0.55
46 0.5
47 0.46
48 0.39
49 0.37
50 0.28
51 0.21
52 0.14
53 0.11
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.06
67 0.07
68 0.1
69 0.11
70 0.17
71 0.22
72 0.3
73 0.4
74 0.46
75 0.57
76 0.64
77 0.74
78 0.79
79 0.86
80 0.86
81 0.86
82 0.81
83 0.77
84 0.66
85 0.56
86 0.47
87 0.36
88 0.28
89 0.18
90 0.16
91 0.09
92 0.09
93 0.1
94 0.09
95 0.1
96 0.11
97 0.14
98 0.18
99 0.18
100 0.2
101 0.26
102 0.33
103 0.31
104 0.35
105 0.33
106 0.28
107 0.28
108 0.26
109 0.2
110 0.12
111 0.11
112 0.08
113 0.08
114 0.07
115 0.07
116 0.07
117 0.1
118 0.12
119 0.12
120 0.1
121 0.1
122 0.11
123 0.11
124 0.11
125 0.08
126 0.07
127 0.07
128 0.09
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.11
138 0.17
139 0.2
140 0.2
141 0.21
142 0.22
143 0.22
144 0.21
145 0.2
146 0.14
147 0.11
148 0.12
149 0.12
150 0.12
151 0.12
152 0.12
153 0.12
154 0.12
155 0.12
156 0.11
157 0.12
158 0.09
159 0.1
160 0.1
161 0.1
162 0.11
163 0.16
164 0.16
165 0.14
166 0.18
167 0.2
168 0.22
169 0.25
170 0.27
171 0.26
172 0.31
173 0.34
174 0.33
175 0.31
176 0.31
177 0.31
178 0.3
179 0.27
180 0.27
181 0.25
182 0.23
183 0.24
184 0.21
185 0.21
186 0.23
187 0.22
188 0.19
189 0.18
190 0.18
191 0.17
192 0.18
193 0.16
194 0.13
195 0.13
196 0.11
197 0.11
198 0.1
199 0.09
200 0.09
201 0.09
202 0.09
203 0.08
204 0.09
205 0.09
206 0.1
207 0.12
208 0.14
209 0.17
210 0.21
211 0.3
212 0.39
213 0.42
214 0.49
215 0.55
216 0.62
217 0.64
218 0.6
219 0.59
220 0.51
221 0.54
222 0.55
223 0.49
224 0.41
225 0.38
226 0.37
227 0.32
228 0.34
229 0.3
230 0.26
231 0.32
232 0.33
233 0.35
234 0.37
235 0.34
236 0.33
237 0.36
238 0.31
239 0.23
240 0.23
241 0.2
242 0.18
243 0.19
244 0.17
245 0.13
246 0.12
247 0.13
248 0.11
249 0.15
250 0.23
251 0.32
252 0.39
253 0.47
254 0.54
255 0.64
256 0.71
257 0.71
258 0.69
259 0.64
260 0.59
261 0.54
262 0.47
263 0.36
264 0.36
265 0.31
266 0.25
267 0.26
268 0.27
269 0.24
270 0.3
271 0.38
272 0.39
273 0.48
274 0.56
275 0.58
276 0.59
277 0.6
278 0.57
279 0.59
280 0.57
281 0.53
282 0.53
283 0.46
284 0.41
285 0.4
286 0.4
287 0.36
288 0.35
289 0.35
290 0.29
291 0.33
292 0.33
293 0.36
294 0.33
295 0.27
296 0.23
297 0.2
298 0.25
299 0.2
300 0.2
301 0.18
302 0.18
303 0.17
304 0.2
305 0.2
306 0.13
307 0.12
308 0.13
309 0.13
310 0.14
311 0.14
312 0.1
313 0.13
314 0.14
315 0.17
316 0.17
317 0.17
318 0.19
319 0.2
320 0.23
321 0.2
322 0.22