Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9L5F3

Protein Details
Accession A0A4Q9L5F3    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-38KNEELLQKRKRIKKIIEETSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR031781  SF3A2_dom  
Gene Ontology GO:0110165  C:cellular anatomical entity  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF16835  SF3A2  
Amino Acid Sequences MVFNNRINTNNSTNISTKNEELLQKRKRIKKIIEETSSIIKDKYHRINSIGKYECLLCYTLHNTEINYISHCQGTKHQNLLKKQIDTEKIIDLKKNKLSPKYIIRNIIQENKKGHNIQLEYTQSTEKPVFKFINSLEQKVEKYNKENIYLVILCEPYINVGFKIENKKVDECSIISYFNEFEKLFTIQFLYLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.39
4 0.35
5 0.33
6 0.34
7 0.37
8 0.41
9 0.47
10 0.49
11 0.54
12 0.63
13 0.68
14 0.72
15 0.75
16 0.77
17 0.78
18 0.81
19 0.82
20 0.77
21 0.72
22 0.65
23 0.63
24 0.56
25 0.46
26 0.35
27 0.28
28 0.27
29 0.32
30 0.38
31 0.38
32 0.38
33 0.41
34 0.5
35 0.51
36 0.57
37 0.52
38 0.42
39 0.37
40 0.36
41 0.32
42 0.25
43 0.22
44 0.13
45 0.13
46 0.16
47 0.16
48 0.17
49 0.17
50 0.16
51 0.18
52 0.19
53 0.17
54 0.15
55 0.15
56 0.14
57 0.15
58 0.15
59 0.14
60 0.18
61 0.25
62 0.27
63 0.32
64 0.34
65 0.39
66 0.42
67 0.5
68 0.48
69 0.42
70 0.41
71 0.4
72 0.4
73 0.37
74 0.35
75 0.3
76 0.29
77 0.29
78 0.3
79 0.26
80 0.28
81 0.3
82 0.34
83 0.34
84 0.34
85 0.37
86 0.39
87 0.46
88 0.5
89 0.49
90 0.49
91 0.46
92 0.47
93 0.47
94 0.5
95 0.43
96 0.4
97 0.39
98 0.37
99 0.41
100 0.36
101 0.34
102 0.31
103 0.3
104 0.27
105 0.29
106 0.28
107 0.25
108 0.25
109 0.25
110 0.18
111 0.21
112 0.22
113 0.19
114 0.18
115 0.23
116 0.23
117 0.22
118 0.26
119 0.23
120 0.31
121 0.3
122 0.3
123 0.28
124 0.29
125 0.3
126 0.33
127 0.38
128 0.31
129 0.34
130 0.4
131 0.41
132 0.42
133 0.42
134 0.36
135 0.36
136 0.32
137 0.29
138 0.23
139 0.19
140 0.16
141 0.15
142 0.14
143 0.1
144 0.12
145 0.12
146 0.1
147 0.11
148 0.13
149 0.18
150 0.27
151 0.29
152 0.32
153 0.35
154 0.39
155 0.4
156 0.41
157 0.39
158 0.31
159 0.33
160 0.29
161 0.27
162 0.24
163 0.23
164 0.21
165 0.19
166 0.22
167 0.16
168 0.15
169 0.17
170 0.19
171 0.17
172 0.17
173 0.18