Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L823

Protein Details
Accession A0A4Q9L823   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23LLNRYKFKSLKRIRSRPVKEILDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 7
Family & Domain DBs
Amino Acid Sequences LLNRYKFKSLKRIRSRPVKEILDNKHAEIRVDPRIKTDVKIWNNRPDIFILDKKKNKITLIEYDLLANELGLIYKCSVEIIPYVMTWDGIVTKYHKSYLKRLEIAMNVEAYIQSIVLKKTVETISFDRRRGLEAGRASMGVIMRSEMHVEPTPPLKEAKKGGDDAKNFKPKNKAPLFHKEEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.85
4 0.84
5 0.79
6 0.76
7 0.75
8 0.72
9 0.7
10 0.64
11 0.58
12 0.55
13 0.48
14 0.42
15 0.36
16 0.34
17 0.35
18 0.38
19 0.36
20 0.33
21 0.38
22 0.39
23 0.37
24 0.38
25 0.38
26 0.42
27 0.52
28 0.54
29 0.58
30 0.62
31 0.61
32 0.56
33 0.47
34 0.42
35 0.37
36 0.39
37 0.36
38 0.41
39 0.45
40 0.48
41 0.51
42 0.51
43 0.48
44 0.46
45 0.44
46 0.42
47 0.42
48 0.4
49 0.35
50 0.31
51 0.3
52 0.25
53 0.2
54 0.12
55 0.06
56 0.04
57 0.04
58 0.04
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.07
79 0.09
80 0.1
81 0.14
82 0.18
83 0.2
84 0.27
85 0.35
86 0.39
87 0.39
88 0.4
89 0.39
90 0.37
91 0.37
92 0.3
93 0.21
94 0.15
95 0.13
96 0.12
97 0.09
98 0.07
99 0.05
100 0.05
101 0.07
102 0.07
103 0.08
104 0.08
105 0.08
106 0.12
107 0.14
108 0.14
109 0.16
110 0.21
111 0.3
112 0.35
113 0.36
114 0.34
115 0.33
116 0.35
117 0.33
118 0.31
119 0.27
120 0.25
121 0.27
122 0.25
123 0.24
124 0.21
125 0.21
126 0.19
127 0.13
128 0.11
129 0.09
130 0.08
131 0.09
132 0.12
133 0.1
134 0.14
135 0.15
136 0.16
137 0.17
138 0.23
139 0.23
140 0.22
141 0.26
142 0.24
143 0.28
144 0.33
145 0.37
146 0.37
147 0.4
148 0.46
149 0.5
150 0.53
151 0.54
152 0.59
153 0.62
154 0.58
155 0.6
156 0.63
157 0.61
158 0.66
159 0.69
160 0.68
161 0.65
162 0.75
163 0.78