Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2JVF9

Protein Details
Accession A0A4V2JVF9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-99AVRHKQPTPSLKEKKNKRDVVKQINTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences NKYKFKSSKRIRSHSVQEILYNEYAEIRVDTRIKTDVNIRCNRPDIFVSDKRKNKIPLIELRERALLTVILGAVRHKQPTPSLKEKKNKRDVVKQINTENIIPFVWMVLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.75
3 0.65
4 0.57
5 0.51
6 0.48
7 0.39
8 0.31
9 0.21
10 0.16
11 0.15
12 0.12
13 0.11
14 0.08
15 0.11
16 0.13
17 0.13
18 0.15
19 0.17
20 0.17
21 0.17
22 0.25
23 0.27
24 0.34
25 0.4
26 0.41
27 0.42
28 0.45
29 0.44
30 0.38
31 0.34
32 0.29
33 0.3
34 0.35
35 0.39
36 0.44
37 0.49
38 0.48
39 0.53
40 0.52
41 0.48
42 0.45
43 0.43
44 0.43
45 0.46
46 0.49
47 0.45
48 0.43
49 0.41
50 0.36
51 0.3
52 0.22
53 0.15
54 0.08
55 0.08
56 0.06
57 0.05
58 0.05
59 0.06
60 0.09
61 0.11
62 0.13
63 0.13
64 0.15
65 0.21
66 0.29
67 0.37
68 0.44
69 0.52
70 0.59
71 0.68
72 0.77
73 0.81
74 0.84
75 0.84
76 0.81
77 0.83
78 0.84
79 0.86
80 0.84
81 0.8
82 0.74
83 0.71
84 0.66
85 0.57
86 0.48
87 0.38
88 0.29
89 0.23
90 0.18
91 0.13