Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LIR2

Protein Details
Accession A0A4Q9LIR2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-90RNWSSFKKFIPNHRRSEKKKLVAFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20, mito 3, pero 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024445  Tnp_ISXO2-like  
Pfam View protein in Pfam  
PF12762  DDE_Tnp_IS1595  
Amino Acid Sequences MLLPILDGTKATPIPIILQLVKPGGIIYTDCWKGYRDLRIYFDRKTVNHSRGVIDAISGVHTHTIERNWSSFKKFIPNHRRSEKKKLVAFIICCCKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.18
4 0.16
5 0.16
6 0.18
7 0.18
8 0.17
9 0.15
10 0.12
11 0.09
12 0.08
13 0.08
14 0.08
15 0.14
16 0.15
17 0.15
18 0.16
19 0.17
20 0.19
21 0.23
22 0.28
23 0.27
24 0.29
25 0.33
26 0.4
27 0.42
28 0.4
29 0.41
30 0.37
31 0.32
32 0.37
33 0.39
34 0.34
35 0.35
36 0.35
37 0.31
38 0.28
39 0.29
40 0.21
41 0.14
42 0.12
43 0.08
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.09
52 0.11
53 0.13
54 0.15
55 0.19
56 0.22
57 0.26
58 0.27
59 0.28
60 0.36
61 0.39
62 0.48
63 0.55
64 0.6
65 0.65
66 0.73
67 0.81
68 0.78
69 0.84
70 0.83
71 0.82
72 0.79
73 0.75
74 0.72
75 0.69
76 0.65
77 0.62