Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LNP2

Protein Details
Accession A0A4Q9LNP2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27ESVGTIKKIKEKKKTNNKWNEIRTSYHydrophilic
NLS Segment(s)
PositionSequence
13-14KK
Subcellular Location(s) nucl 11, cyto 8.5, cyto_pero 6, mito 4, pero 2.5
Family & Domain DBs
Amino Acid Sequences MESVGTIKKIKEKKKTNNKWNEIRTSYACVPDNEYNLNYFYTPQFDDDSLHELTSDEIEMIKRWKDDPLPIVDKNVSLYLTYTNTSVND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.86
3 0.89
4 0.91
5 0.92
6 0.91
7 0.87
8 0.85
9 0.76
10 0.7
11 0.62
12 0.57
13 0.5
14 0.45
15 0.39
16 0.31
17 0.34
18 0.31
19 0.31
20 0.26
21 0.24
22 0.2
23 0.19
24 0.19
25 0.13
26 0.12
27 0.1
28 0.11
29 0.11
30 0.11
31 0.11
32 0.11
33 0.12
34 0.12
35 0.15
36 0.13
37 0.13
38 0.11
39 0.1
40 0.1
41 0.09
42 0.08
43 0.05
44 0.05
45 0.06
46 0.07
47 0.09
48 0.11
49 0.11
50 0.12
51 0.16
52 0.18
53 0.23
54 0.27
55 0.33
56 0.37
57 0.36
58 0.39
59 0.36
60 0.34
61 0.31
62 0.28
63 0.2
64 0.15
65 0.15
66 0.15
67 0.16
68 0.17
69 0.15