Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9L8I4

Protein Details
Accession A0A4Q9L8I4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-56LPQFLLTKRKIKNKVNNYEHSKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 10, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Amino Acid Sequences MNKNRWDSFEERIYKEKDIDNTNIDKDIINDAALPQFLLTKRKIKNKVNNYEHSKSLEVENCNFPYLVTRIRTLIELDELYGVEILKRGTLSPLKLQTETTDNLLCLEVTGKYLHNIDCAILKLKEIMKKGELALSFKSGEVRNVYNGYKNIISCKIEVGIYEIKNDFSIKEIVIFHLKRISEDLSKYRNKNTNFLEMIKFGEYTNEFVILDNLVIRLRGRYSGTIEICLDSESNDPCYLQVLATDLEYFKKGEYICKELIKKIKSEYFNIKNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.48
4 0.45
5 0.44
6 0.44
7 0.43
8 0.44
9 0.43
10 0.4
11 0.36
12 0.29
13 0.26
14 0.25
15 0.2
16 0.15
17 0.14
18 0.13
19 0.14
20 0.14
21 0.12
22 0.08
23 0.12
24 0.14
25 0.19
26 0.22
27 0.29
28 0.36
29 0.47
30 0.56
31 0.62
32 0.71
33 0.77
34 0.84
35 0.84
36 0.86
37 0.85
38 0.79
39 0.72
40 0.65
41 0.55
42 0.45
43 0.42
44 0.38
45 0.33
46 0.33
47 0.35
48 0.32
49 0.32
50 0.31
51 0.25
52 0.23
53 0.22
54 0.24
55 0.2
56 0.21
57 0.21
58 0.21
59 0.22
60 0.2
61 0.18
62 0.15
63 0.13
64 0.12
65 0.11
66 0.1
67 0.1
68 0.09
69 0.08
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.1
77 0.13
78 0.15
79 0.2
80 0.26
81 0.28
82 0.29
83 0.29
84 0.26
85 0.27
86 0.26
87 0.23
88 0.17
89 0.15
90 0.15
91 0.15
92 0.13
93 0.09
94 0.09
95 0.06
96 0.06
97 0.08
98 0.07
99 0.08
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.09
106 0.1
107 0.12
108 0.1
109 0.1
110 0.12
111 0.15
112 0.19
113 0.19
114 0.2
115 0.18
116 0.19
117 0.2
118 0.2
119 0.18
120 0.16
121 0.15
122 0.15
123 0.15
124 0.13
125 0.16
126 0.13
127 0.14
128 0.14
129 0.14
130 0.14
131 0.16
132 0.17
133 0.17
134 0.17
135 0.18
136 0.17
137 0.17
138 0.17
139 0.18
140 0.19
141 0.16
142 0.16
143 0.15
144 0.13
145 0.13
146 0.15
147 0.16
148 0.15
149 0.17
150 0.16
151 0.16
152 0.16
153 0.16
154 0.12
155 0.1
156 0.11
157 0.08
158 0.11
159 0.11
160 0.12
161 0.19
162 0.19
163 0.18
164 0.21
165 0.21
166 0.19
167 0.21
168 0.23
169 0.19
170 0.23
171 0.28
172 0.31
173 0.38
174 0.4
175 0.45
176 0.49
177 0.48
178 0.53
179 0.5
180 0.51
181 0.47
182 0.48
183 0.42
184 0.36
185 0.36
186 0.29
187 0.25
188 0.16
189 0.18
190 0.16
191 0.16
192 0.16
193 0.15
194 0.14
195 0.13
196 0.14
197 0.1
198 0.1
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.08
205 0.09
206 0.12
207 0.14
208 0.16
209 0.21
210 0.28
211 0.29
212 0.3
213 0.3
214 0.27
215 0.25
216 0.23
217 0.19
218 0.12
219 0.14
220 0.13
221 0.15
222 0.15
223 0.15
224 0.14
225 0.16
226 0.15
227 0.12
228 0.11
229 0.1
230 0.11
231 0.11
232 0.12
233 0.11
234 0.12
235 0.13
236 0.13
237 0.11
238 0.15
239 0.15
240 0.22
241 0.27
242 0.31
243 0.36
244 0.43
245 0.46
246 0.5
247 0.58
248 0.53
249 0.52
250 0.53
251 0.57
252 0.53
253 0.57
254 0.6