Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KW27

Protein Details
Accession A0A4Q9KW27    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-117EDPALELPKKKKRIPKNNKENNTNSHydrophilic
NLS Segment(s)
PositionSequence
101-109KKKKRIPKN
Subcellular Location(s) nucl 19.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000313  PWWP_dom  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05162  PWWP  
Amino Acid Sequences MFKPGDVVWSKYDEYPYWPSRIASKDVTDTLQSYNNTNLGIGVLFFGQNLTYALVEEKNICEFFENYKFYYKASNEEDFRFAIEQAKSNQNIEDPALELPKKKKRIPKNNKENNTNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.33
3 0.34
4 0.33
5 0.33
6 0.32
7 0.34
8 0.37
9 0.36
10 0.32
11 0.31
12 0.31
13 0.31
14 0.32
15 0.27
16 0.25
17 0.22
18 0.24
19 0.21
20 0.2
21 0.2
22 0.19
23 0.18
24 0.16
25 0.14
26 0.09
27 0.08
28 0.07
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.05
38 0.04
39 0.05
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.08
47 0.07
48 0.08
49 0.09
50 0.12
51 0.17
52 0.19
53 0.18
54 0.22
55 0.22
56 0.21
57 0.27
58 0.24
59 0.24
60 0.27
61 0.32
62 0.3
63 0.32
64 0.33
65 0.27
66 0.28
67 0.23
68 0.18
69 0.18
70 0.17
71 0.18
72 0.2
73 0.26
74 0.26
75 0.26
76 0.27
77 0.23
78 0.23
79 0.21
80 0.18
81 0.13
82 0.13
83 0.17
84 0.17
85 0.21
86 0.28
87 0.37
88 0.44
89 0.49
90 0.57
91 0.64
92 0.75
93 0.82
94 0.85
95 0.87
96 0.9
97 0.93