Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LKE9

Protein Details
Accession A0A4Q9LKE9    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-44ELKAYKRTCEQIKRQQQNNERSQNYHydrophilic
58-80GPNNKRNKSRSYKKVRHDKNDNAHydrophilic
84-113SEQEGNKKERKRNRKLRKKEDSKSKNDPLNBasic
NLS Segment(s)
PositionSequence
89-107NKKERKRNRKLRKKEDSKS
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKYILYVLLPNITSTGISSELKAYKRTCEQIKRQQQNNERSQNYIISYSKQGETVNFGPNNKRNKSRSYKKVRHDKNDNASTESEQEGNKKERKRNRKLRKKEDSKSKNDPLNKYLTSSRILKDDPTFDTIPKDEKMDGSGQSSHSCVTSEDYFADTSDFCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.13
6 0.17
7 0.21
8 0.23
9 0.28
10 0.28
11 0.31
12 0.37
13 0.43
14 0.48
15 0.53
16 0.61
17 0.67
18 0.76
19 0.8
20 0.81
21 0.83
22 0.83
23 0.83
24 0.83
25 0.81
26 0.71
27 0.65
28 0.59
29 0.52
30 0.44
31 0.38
32 0.3
33 0.23
34 0.25
35 0.24
36 0.23
37 0.22
38 0.2
39 0.17
40 0.21
41 0.21
42 0.25
43 0.24
44 0.25
45 0.3
46 0.36
47 0.44
48 0.42
49 0.47
50 0.43
51 0.51
52 0.6
53 0.64
54 0.68
55 0.71
56 0.76
57 0.77
58 0.85
59 0.84
60 0.83
61 0.82
62 0.8
63 0.78
64 0.76
65 0.68
66 0.6
67 0.52
68 0.43
69 0.36
70 0.28
71 0.2
72 0.13
73 0.14
74 0.16
75 0.21
76 0.25
77 0.3
78 0.37
79 0.45
80 0.56
81 0.65
82 0.72
83 0.78
84 0.84
85 0.89
86 0.92
87 0.94
88 0.94
89 0.92
90 0.92
91 0.89
92 0.87
93 0.85
94 0.81
95 0.77
96 0.73
97 0.68
98 0.6
99 0.58
100 0.5
101 0.44
102 0.4
103 0.35
104 0.32
105 0.31
106 0.29
107 0.26
108 0.26
109 0.26
110 0.27
111 0.28
112 0.27
113 0.29
114 0.29
115 0.25
116 0.28
117 0.27
118 0.27
119 0.25
120 0.25
121 0.2
122 0.2
123 0.22
124 0.21
125 0.21
126 0.21
127 0.22
128 0.22
129 0.22
130 0.22
131 0.2
132 0.17
133 0.17
134 0.14
135 0.17
136 0.17
137 0.17
138 0.17
139 0.18
140 0.18
141 0.18
142 0.18