Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LH38

Protein Details
Accession A0A4Q9LH38    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-34LPNCSQKSKETHRDGFKHKQLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013085  U1-CZ_Znf_C2H2  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF06220  zf-U1  
Amino Acid Sequences MSRFYCDFCKVILPNCSQKSKETHRDGFKHKQLRTTYYNDILSKKEIFSKINDTIYKIKMYNNIKQSEEVIKINENPRKNIEKVEKKDENKIKSEFLNIFNESCNKIQNSKFEMPNFNIPPDFIYPPPPKNFRLPKDFDFSNISNFPKNIQKAIQKFTSDSHNYDSEVQKCKLHPPAISLPSSSYTTITPPPPSQTCSKMQNSGLDTLPSPKAPVPSSVEVSACEPSYDMTSPCTLAIPEGNRLMALRTIFDSVTADLNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.57
4 0.51
5 0.54
6 0.57
7 0.6
8 0.64
9 0.64
10 0.66
11 0.7
12 0.77
13 0.8
14 0.81
15 0.81
16 0.79
17 0.72
18 0.72
19 0.67
20 0.66
21 0.64
22 0.6
23 0.57
24 0.54
25 0.56
26 0.51
27 0.48
28 0.44
29 0.41
30 0.36
31 0.31
32 0.32
33 0.3
34 0.29
35 0.31
36 0.36
37 0.37
38 0.41
39 0.41
40 0.38
41 0.41
42 0.41
43 0.4
44 0.34
45 0.32
46 0.33
47 0.38
48 0.41
49 0.43
50 0.45
51 0.42
52 0.42
53 0.43
54 0.39
55 0.37
56 0.31
57 0.25
58 0.24
59 0.27
60 0.34
61 0.36
62 0.33
63 0.33
64 0.37
65 0.41
66 0.4
67 0.44
68 0.47
69 0.52
70 0.55
71 0.62
72 0.64
73 0.61
74 0.7
75 0.69
76 0.63
77 0.58
78 0.55
79 0.48
80 0.4
81 0.43
82 0.36
83 0.32
84 0.32
85 0.27
86 0.26
87 0.24
88 0.25
89 0.23
90 0.2
91 0.19
92 0.16
93 0.2
94 0.22
95 0.26
96 0.32
97 0.34
98 0.37
99 0.37
100 0.4
101 0.38
102 0.43
103 0.38
104 0.32
105 0.27
106 0.23
107 0.22
108 0.21
109 0.2
110 0.13
111 0.19
112 0.22
113 0.26
114 0.3
115 0.32
116 0.31
117 0.38
118 0.45
119 0.43
120 0.47
121 0.49
122 0.47
123 0.49
124 0.47
125 0.41
126 0.38
127 0.34
128 0.3
129 0.27
130 0.26
131 0.22
132 0.22
133 0.22
134 0.23
135 0.23
136 0.21
137 0.23
138 0.29
139 0.32
140 0.36
141 0.38
142 0.32
143 0.32
144 0.32
145 0.35
146 0.31
147 0.29
148 0.28
149 0.25
150 0.25
151 0.28
152 0.31
153 0.28
154 0.31
155 0.31
156 0.3
157 0.3
158 0.34
159 0.37
160 0.37
161 0.32
162 0.33
163 0.39
164 0.41
165 0.4
166 0.36
167 0.3
168 0.29
169 0.3
170 0.24
171 0.17
172 0.14
173 0.15
174 0.19
175 0.2
176 0.21
177 0.21
178 0.26
179 0.27
180 0.3
181 0.31
182 0.33
183 0.36
184 0.4
185 0.42
186 0.42
187 0.42
188 0.45
189 0.43
190 0.42
191 0.37
192 0.3
193 0.27
194 0.26
195 0.25
196 0.19
197 0.19
198 0.18
199 0.21
200 0.21
201 0.25
202 0.27
203 0.3
204 0.33
205 0.33
206 0.31
207 0.28
208 0.29
209 0.27
210 0.2
211 0.16
212 0.13
213 0.12
214 0.15
215 0.16
216 0.14
217 0.14
218 0.16
219 0.16
220 0.16
221 0.16
222 0.13
223 0.13
224 0.18
225 0.18
226 0.21
227 0.22
228 0.22
229 0.21
230 0.22
231 0.22
232 0.2
233 0.18
234 0.15
235 0.15
236 0.17
237 0.17
238 0.17
239 0.17
240 0.15