Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LJS6

Protein Details
Accession A0A4Q9LJS6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-105PSTSRTHSYNLRHKRKKPQKREGKKRLIYTSEFHydrophilic
NLS Segment(s)
PositionSequence
84-98RHKRKKPQKREGKKR
Subcellular Location(s) nucl 13.5, mito_nucl 10.833, mito 7, cyto_mito 5.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MYFQGFVYTENFGLVVLLFLTCKSSNKLRDKSKSISDLPKDEQRGIYCSRNGASGSSDISTHGTTVHVSEEEPSTSRTHSYNLRHKRKKPQKREGKKRLIYTSEFDGSYSPHNTNDIII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.08
8 0.09
9 0.11
10 0.15
11 0.22
12 0.32
13 0.41
14 0.5
15 0.56
16 0.64
17 0.69
18 0.7
19 0.7
20 0.66
21 0.62
22 0.62
23 0.57
24 0.53
25 0.51
26 0.52
27 0.48
28 0.43
29 0.4
30 0.32
31 0.32
32 0.31
33 0.3
34 0.25
35 0.24
36 0.23
37 0.22
38 0.2
39 0.17
40 0.14
41 0.11
42 0.11
43 0.1
44 0.1
45 0.09
46 0.1
47 0.09
48 0.08
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.1
61 0.1
62 0.11
63 0.12
64 0.12
65 0.14
66 0.21
67 0.28
68 0.37
69 0.47
70 0.58
71 0.66
72 0.73
73 0.81
74 0.85
75 0.88
76 0.89
77 0.89
78 0.9
79 0.92
80 0.96
81 0.95
82 0.95
83 0.92
84 0.89
85 0.86
86 0.81
87 0.73
88 0.66
89 0.61
90 0.53
91 0.45
92 0.37
93 0.3
94 0.25
95 0.26
96 0.26
97 0.2
98 0.18
99 0.2