Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KXG5

Protein Details
Accession A0A4Q9KXG5   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-39YTYVFKQQKRSERQSKKILFKTRYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MFHAGLNRSSTSEIAYTYVFKQQKRSERQSKKILFKTRYYYNSKLLYMLLSMFKRLADIKAEEEFKRSERKRIIIIFAFLTIFFDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.22
6 0.24
7 0.24
8 0.32
9 0.38
10 0.47
11 0.54
12 0.63
13 0.66
14 0.72
15 0.8
16 0.82
17 0.82
18 0.82
19 0.81
20 0.8
21 0.74
22 0.69
23 0.66
24 0.63
25 0.62
26 0.59
27 0.54
28 0.51
29 0.49
30 0.44
31 0.39
32 0.31
33 0.25
34 0.18
35 0.16
36 0.14
37 0.11
38 0.11
39 0.11
40 0.1
41 0.11
42 0.12
43 0.12
44 0.12
45 0.13
46 0.16
47 0.2
48 0.24
49 0.23
50 0.25
51 0.25
52 0.24
53 0.33
54 0.32
55 0.37
56 0.41
57 0.45
58 0.5
59 0.52
60 0.57
61 0.5
62 0.51
63 0.43
64 0.37
65 0.33
66 0.26