Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KWH1

Protein Details
Accession A0A4Q9KWH1    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTNKNGNKNKTKDKPIGEKPLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001412  aa-tRNA-synth_I_CS  
IPR000924  Glu/Gln-tRNA-synth  
IPR020058  Glu/Gln-tRNA-synth_Ib_cat-dom  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006418  P:tRNA aminoacylation for protein translation  
Pfam View protein in Pfam  
PF00749  tRNA-synt_1c  
PROSITE View protein in PROSITE  
PS00178  AA_TRNA_LIGASE_I  
Amino Acid Sequences MTNKNGNKNKTKDKPIGEKPLGDNPSNPHKHNPSNPHNPHVDSNWLSIGEVSKLNNIHHTINTPSVLSTHLSSSPALTVTRFPPEPNGYLHLGHAKAINLSFEYSLINNGVTYLRFDDTNPRNEKEEFYKSIVKDVEWLGFKPFKITYASDYFDILIDYAFKLIDKGKAYVCHLDLETMRQGRRVGYSMLEGDNDRDILEGDIGSGILEGDIGSGNYNPVSNSSNKQQGVNNKDSNYNPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.85
4 0.77
5 0.73
6 0.68
7 0.68
8 0.63
9 0.54
10 0.47
11 0.42
12 0.49
13 0.49
14 0.47
15 0.46
16 0.5
17 0.57
18 0.63
19 0.68
20 0.67
21 0.73
22 0.75
23 0.72
24 0.69
25 0.63
26 0.58
27 0.5
28 0.48
29 0.39
30 0.36
31 0.32
32 0.28
33 0.25
34 0.22
35 0.2
36 0.14
37 0.14
38 0.12
39 0.14
40 0.16
41 0.16
42 0.2
43 0.21
44 0.22
45 0.21
46 0.23
47 0.22
48 0.23
49 0.23
50 0.19
51 0.17
52 0.15
53 0.15
54 0.14
55 0.12
56 0.11
57 0.12
58 0.12
59 0.12
60 0.12
61 0.12
62 0.12
63 0.11
64 0.1
65 0.11
66 0.12
67 0.16
68 0.16
69 0.16
70 0.2
71 0.23
72 0.24
73 0.23
74 0.25
75 0.23
76 0.23
77 0.23
78 0.21
79 0.18
80 0.17
81 0.16
82 0.13
83 0.12
84 0.12
85 0.11
86 0.08
87 0.09
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.08
103 0.08
104 0.17
105 0.2
106 0.28
107 0.31
108 0.3
109 0.33
110 0.33
111 0.35
112 0.31
113 0.33
114 0.28
115 0.28
116 0.32
117 0.3
118 0.33
119 0.32
120 0.26
121 0.23
122 0.21
123 0.21
124 0.17
125 0.17
126 0.16
127 0.18
128 0.17
129 0.18
130 0.17
131 0.15
132 0.16
133 0.17
134 0.18
135 0.21
136 0.22
137 0.2
138 0.21
139 0.19
140 0.17
141 0.16
142 0.11
143 0.07
144 0.06
145 0.05
146 0.05
147 0.05
148 0.04
149 0.05
150 0.07
151 0.12
152 0.13
153 0.15
154 0.17
155 0.2
156 0.23
157 0.26
158 0.26
159 0.23
160 0.22
161 0.22
162 0.2
163 0.21
164 0.24
165 0.24
166 0.23
167 0.23
168 0.24
169 0.23
170 0.25
171 0.24
172 0.2
173 0.17
174 0.2
175 0.19
176 0.2
177 0.19
178 0.17
179 0.16
180 0.16
181 0.14
182 0.12
183 0.1
184 0.09
185 0.09
186 0.09
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.05
193 0.04
194 0.03
195 0.04
196 0.03
197 0.03
198 0.04
199 0.04
200 0.05
201 0.05
202 0.07
203 0.07
204 0.08
205 0.08
206 0.1
207 0.13
208 0.16
209 0.21
210 0.28
211 0.36
212 0.37
213 0.4
214 0.44
215 0.5
216 0.55
217 0.59
218 0.58
219 0.52
220 0.56