Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L5T0

Protein Details
Accession A0A4Q9L5T0   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-38KENGSLKRMFRKNKIVRNKRKLRIKSIGFKHydrophilic
NLS Segment(s)
PositionSequence
8-36EKENGSLKRMFRKNKIVRNKRKLRIKSIG
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKNMKEREKENGSLKRMFRKNKIVRNKRKLRIKSIGFKNFLTKKKYLDRENGNFFIKEFVIEKENCITEQRIGCGIKSWENLLLEGKENAEKNILVRVVKDLVGELKKKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.65
4 0.66
5 0.65
6 0.68
7 0.72
8 0.75
9 0.82
10 0.83
11 0.86
12 0.89
13 0.92
14 0.9
15 0.9
16 0.87
17 0.85
18 0.84
19 0.81
20 0.8
21 0.79
22 0.78
23 0.71
24 0.65
25 0.64
26 0.62
27 0.59
28 0.55
29 0.46
30 0.44
31 0.49
32 0.56
33 0.52
34 0.53
35 0.55
36 0.56
37 0.61
38 0.58
39 0.51
40 0.43
41 0.38
42 0.31
43 0.23
44 0.17
45 0.12
46 0.1
47 0.12
48 0.12
49 0.13
50 0.14
51 0.15
52 0.14
53 0.15
54 0.15
55 0.15
56 0.16
57 0.16
58 0.18
59 0.18
60 0.18
61 0.2
62 0.21
63 0.21
64 0.21
65 0.21
66 0.2
67 0.2
68 0.21
69 0.2
70 0.19
71 0.17
72 0.16
73 0.16
74 0.17
75 0.17
76 0.17
77 0.16
78 0.16
79 0.15
80 0.2
81 0.21
82 0.17
83 0.17
84 0.21
85 0.21
86 0.21
87 0.2
88 0.16
89 0.21
90 0.26
91 0.28