Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9L0K3

Protein Details
Accession A0A4Q9L0K3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-88GTTFEKPTKKTRRVGFRRRNDSGKRGRRKHIKMVKIFBasic
NLS Segment(s)
PositionSequence
57-84KPTKKTRRVGFRRRNDSGKRGRRKHIKM
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPKRRERASTGVIMRAGMYEEPKFPLKEAKRDEYGIKTENRKNNTSLISLRGTTFEKPTKKTRRVGFRRRNDSGKRGRRKHIKMVKIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.27
3 0.23
4 0.15
5 0.15
6 0.12
7 0.13
8 0.16
9 0.19
10 0.19
11 0.18
12 0.27
13 0.28
14 0.36
15 0.41
16 0.43
17 0.43
18 0.45
19 0.47
20 0.41
21 0.41
22 0.36
23 0.34
24 0.35
25 0.38
26 0.42
27 0.44
28 0.42
29 0.4
30 0.4
31 0.37
32 0.33
33 0.28
34 0.25
35 0.22
36 0.21
37 0.19
38 0.18
39 0.18
40 0.16
41 0.2
42 0.23
43 0.26
44 0.3
45 0.4
46 0.48
47 0.54
48 0.6
49 0.64
50 0.68
51 0.75
52 0.82
53 0.82
54 0.83
55 0.85
56 0.84
57 0.86
58 0.82
59 0.81
60 0.81
61 0.81
62 0.81
63 0.8
64 0.83
65 0.85
66 0.85
67 0.86
68 0.85