Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2JWU1

Protein Details
Accession A0A4V2JWU1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
207-248DEKPLPIPIKPPKRQRGGRKFRKIKNKIKKRIEYSTRQLNKDBasic
NLS Segment(s)
PositionSequence
201-237KVEPKKDEKPLPIPIKPPKRQRGGRKFRKIKNKIKKR
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036070  Nop_dom_sf  
IPR019175  Prp31_C  
Pfam View protein in Pfam  
PF09785  Prp31_C  
Amino Acid Sequences MEDMCNKLLSLRKQEIEIRSKISLNFPMSLLKRIVKSEENAILNQENNYCNSYSILEMLEYKKFKNIYFEMNFDEKRNVLEIFDKLTEIETEKEELFLANKELLEKNYYNLNNILGPKILFNLLYYVDFKSLVYKTSNEFRNILMKCDIQNHLLFLELDKSKKNQLLRIISNKACIAAKLDYFGSKKIDFLSEIKIFFKEKVEPKKDEKPLPIPIKPPKRQRGGRKFRKIKNKIKKRIEYSTRQLNKDEFDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.57
4 0.54
5 0.49
6 0.45
7 0.46
8 0.44
9 0.42
10 0.41
11 0.36
12 0.34
13 0.3
14 0.35
15 0.34
16 0.36
17 0.34
18 0.3
19 0.3
20 0.31
21 0.35
22 0.31
23 0.32
24 0.34
25 0.38
26 0.37
27 0.34
28 0.35
29 0.32
30 0.29
31 0.28
32 0.25
33 0.19
34 0.19
35 0.2
36 0.18
37 0.16
38 0.17
39 0.16
40 0.14
41 0.13
42 0.12
43 0.1
44 0.13
45 0.14
46 0.19
47 0.19
48 0.19
49 0.22
50 0.24
51 0.24
52 0.29
53 0.29
54 0.32
55 0.34
56 0.36
57 0.36
58 0.4
59 0.4
60 0.34
61 0.33
62 0.24
63 0.23
64 0.22
65 0.17
66 0.13
67 0.15
68 0.14
69 0.16
70 0.16
71 0.15
72 0.13
73 0.13
74 0.13
75 0.11
76 0.12
77 0.1
78 0.11
79 0.11
80 0.11
81 0.11
82 0.1
83 0.1
84 0.09
85 0.09
86 0.08
87 0.08
88 0.1
89 0.11
90 0.12
91 0.15
92 0.14
93 0.14
94 0.2
95 0.2
96 0.2
97 0.19
98 0.19
99 0.18
100 0.18
101 0.17
102 0.11
103 0.11
104 0.1
105 0.1
106 0.09
107 0.07
108 0.06
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.08
117 0.11
118 0.1
119 0.11
120 0.11
121 0.12
122 0.14
123 0.21
124 0.24
125 0.23
126 0.23
127 0.23
128 0.29
129 0.28
130 0.29
131 0.24
132 0.22
133 0.21
134 0.24
135 0.25
136 0.19
137 0.19
138 0.18
139 0.15
140 0.15
141 0.14
142 0.1
143 0.14
144 0.12
145 0.13
146 0.14
147 0.16
148 0.19
149 0.23
150 0.25
151 0.25
152 0.31
153 0.38
154 0.43
155 0.49
156 0.51
157 0.48
158 0.48
159 0.44
160 0.38
161 0.3
162 0.24
163 0.2
164 0.16
165 0.15
166 0.14
167 0.15
168 0.17
169 0.18
170 0.2
171 0.21
172 0.19
173 0.19
174 0.19
175 0.2
176 0.18
177 0.19
178 0.24
179 0.23
180 0.24
181 0.25
182 0.25
183 0.24
184 0.23
185 0.25
186 0.25
187 0.31
188 0.41
189 0.46
190 0.5
191 0.56
192 0.65
193 0.7
194 0.69
195 0.67
196 0.63
197 0.67
198 0.69
199 0.66
200 0.65
201 0.67
202 0.71
203 0.72
204 0.76
205 0.75
206 0.78
207 0.83
208 0.86
209 0.87
210 0.88
211 0.91
212 0.91
213 0.92
214 0.91
215 0.93
216 0.92
217 0.92
218 0.92
219 0.92
220 0.92
221 0.92
222 0.93
223 0.9
224 0.91
225 0.89
226 0.87
227 0.85
228 0.85
229 0.82
230 0.75
231 0.71
232 0.64