Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LGC1

Protein Details
Accession A0A4Q9LGC1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-71IESFKRKKNKAITKAKKEELKKELRRAKKKRSIKRKGMLLDSVBasic
NLS Segment(s)
PositionSequence
33-65KRKKNKAITKAKKEELKKELRRAKKKRSIKRKG
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MAIKFDDLVKKKKEKVQLEFSDISRKTFIESFKRKKNKAITKAKKEELKKELRRAKKKRSIKRKGMLLDSVHPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.71
4 0.69
5 0.68
6 0.64
7 0.59
8 0.58
9 0.5
10 0.43
11 0.34
12 0.28
13 0.24
14 0.24
15 0.27
16 0.28
17 0.38
18 0.43
19 0.52
20 0.61
21 0.6
22 0.65
23 0.7
24 0.7
25 0.71
26 0.75
27 0.75
28 0.77
29 0.83
30 0.81
31 0.78
32 0.72
33 0.7
34 0.67
35 0.68
36 0.65
37 0.68
38 0.72
39 0.75
40 0.82
41 0.83
42 0.85
43 0.85
44 0.88
45 0.89
46 0.91
47 0.91
48 0.91
49 0.91
50 0.89
51 0.85
52 0.81
53 0.77
54 0.7