Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LD05

Protein Details
Accession A0A4Q9LD05    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-75VLCSNLNNRKNKKYKYINTDVLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 7, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045886  ThiF/MoeB/HesA  
IPR000594  ThiF_NAD_FAD-bd  
IPR035985  Ubiquitin-activating_enz  
Gene Ontology GO:0019781  F:NEDD8 activating enzyme activity  
GO:0045116  P:protein neddylation  
Pfam View protein in Pfam  
PF00899  ThiF  
Amino Acid Sequences MQILVLGSELIKLLITQKEYKITLLDYDEIEISNLNRQFMYLKKDIGKNKAEVLCSNLNNRKNKKYKYINTDVLKLKEEDIKHFDIIISCLDNIVARMHINFLIKKSVKNIFFIDSGIENMKIHVKVVKKGFSCLYCIKEMYNTQVNLSFCTIKNIEKNLSKYSRHQIILSLIIQFKEKAKENLSYLSNNLPGDLTKDLSNNLTKDLSNNLENNLSNNLTKDLESNLSKDLSNTLECKLPKDLSNNSTKDLSNNLENNLESNLTKDLSNNLNKIISKPNKISIDSNNRNISNFIESVKLKFNKLALSNNLKPTNSFEIIGIERDIIPNVCYINSIAASLIFKEIKSIKSNKEYDYIFYNSEYKIYTQKFLLSKSDSCILCNED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.23
4 0.26
5 0.32
6 0.33
7 0.34
8 0.32
9 0.29
10 0.28
11 0.27
12 0.26
13 0.21
14 0.21
15 0.21
16 0.18
17 0.17
18 0.15
19 0.12
20 0.17
21 0.18
22 0.17
23 0.17
24 0.17
25 0.2
26 0.24
27 0.31
28 0.27
29 0.31
30 0.37
31 0.44
32 0.51
33 0.56
34 0.57
35 0.52
36 0.56
37 0.55
38 0.51
39 0.44
40 0.44
41 0.44
42 0.4
43 0.47
44 0.46
45 0.49
46 0.56
47 0.62
48 0.66
49 0.68
50 0.73
51 0.74
52 0.78
53 0.8
54 0.8
55 0.83
56 0.82
57 0.76
58 0.77
59 0.72
60 0.64
61 0.57
62 0.48
63 0.41
64 0.37
65 0.35
66 0.33
67 0.32
68 0.33
69 0.3
70 0.3
71 0.28
72 0.24
73 0.23
74 0.19
75 0.15
76 0.11
77 0.11
78 0.11
79 0.1
80 0.09
81 0.09
82 0.08
83 0.07
84 0.08
85 0.09
86 0.12
87 0.15
88 0.16
89 0.16
90 0.25
91 0.25
92 0.26
93 0.3
94 0.35
95 0.33
96 0.35
97 0.35
98 0.29
99 0.29
100 0.27
101 0.24
102 0.17
103 0.17
104 0.15
105 0.14
106 0.1
107 0.11
108 0.14
109 0.13
110 0.13
111 0.15
112 0.17
113 0.22
114 0.27
115 0.33
116 0.3
117 0.33
118 0.36
119 0.33
120 0.36
121 0.34
122 0.32
123 0.27
124 0.27
125 0.25
126 0.25
127 0.24
128 0.24
129 0.26
130 0.23
131 0.22
132 0.26
133 0.26
134 0.23
135 0.24
136 0.22
137 0.16
138 0.2
139 0.2
140 0.19
141 0.23
142 0.24
143 0.27
144 0.29
145 0.32
146 0.35
147 0.39
148 0.39
149 0.4
150 0.44
151 0.46
152 0.42
153 0.39
154 0.34
155 0.31
156 0.32
157 0.27
158 0.22
159 0.16
160 0.16
161 0.16
162 0.14
163 0.14
164 0.15
165 0.17
166 0.18
167 0.19
168 0.22
169 0.23
170 0.27
171 0.27
172 0.24
173 0.22
174 0.21
175 0.21
176 0.18
177 0.16
178 0.12
179 0.1
180 0.11
181 0.11
182 0.1
183 0.08
184 0.09
185 0.1
186 0.12
187 0.14
188 0.12
189 0.13
190 0.13
191 0.12
192 0.13
193 0.15
194 0.16
195 0.16
196 0.16
197 0.16
198 0.17
199 0.17
200 0.17
201 0.17
202 0.15
203 0.13
204 0.13
205 0.14
206 0.12
207 0.12
208 0.12
209 0.11
210 0.14
211 0.14
212 0.15
213 0.15
214 0.15
215 0.15
216 0.14
217 0.15
218 0.13
219 0.14
220 0.14
221 0.13
222 0.17
223 0.17
224 0.19
225 0.21
226 0.21
227 0.22
228 0.26
229 0.31
230 0.31
231 0.39
232 0.38
233 0.37
234 0.38
235 0.35
236 0.31
237 0.29
238 0.27
239 0.24
240 0.25
241 0.24
242 0.23
243 0.23
244 0.22
245 0.2
246 0.18
247 0.12
248 0.12
249 0.12
250 0.11
251 0.11
252 0.11
253 0.14
254 0.2
255 0.24
256 0.24
257 0.24
258 0.27
259 0.27
260 0.29
261 0.35
262 0.35
263 0.37
264 0.39
265 0.44
266 0.45
267 0.47
268 0.48
269 0.48
270 0.53
271 0.53
272 0.57
273 0.56
274 0.52
275 0.5
276 0.47
277 0.4
278 0.33
279 0.27
280 0.21
281 0.2
282 0.2
283 0.22
284 0.3
285 0.3
286 0.27
287 0.29
288 0.3
289 0.3
290 0.33
291 0.37
292 0.36
293 0.43
294 0.48
295 0.54
296 0.56
297 0.5
298 0.47
299 0.47
300 0.46
301 0.39
302 0.34
303 0.26
304 0.26
305 0.27
306 0.28
307 0.23
308 0.16
309 0.15
310 0.15
311 0.16
312 0.12
313 0.11
314 0.11
315 0.11
316 0.1
317 0.11
318 0.11
319 0.12
320 0.12
321 0.11
322 0.1
323 0.11
324 0.11
325 0.11
326 0.15
327 0.13
328 0.13
329 0.18
330 0.21
331 0.24
332 0.31
333 0.37
334 0.4
335 0.49
336 0.54
337 0.52
338 0.55
339 0.52
340 0.48
341 0.47
342 0.42
343 0.34
344 0.32
345 0.32
346 0.26
347 0.26
348 0.25
349 0.21
350 0.27
351 0.28
352 0.29
353 0.28
354 0.34
355 0.36
356 0.38
357 0.43
358 0.4
359 0.4
360 0.41
361 0.47
362 0.4
363 0.38