Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KQ48

Protein Details
Accession A0A4Q9KQ48    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
104-132KYSKVYPRVCGKKRQGKERRINYKPEPVYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRSNQHPLKVSNIVRQLEGKSDKVAVVVGKVLDDERMIEIPGIRVVALEFSRTAQKKIEKFGGECFTLDRLFKVVKCMDDIVLMSGDRTNRKAFKYFGVTGEKYSKVYPRVCGKKRQGKERRINYKPEPVYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.46
4 0.4
5 0.39
6 0.39
7 0.33
8 0.27
9 0.27
10 0.25
11 0.23
12 0.23
13 0.15
14 0.12
15 0.12
16 0.1
17 0.09
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.09
30 0.08
31 0.06
32 0.06
33 0.06
34 0.08
35 0.08
36 0.08
37 0.07
38 0.08
39 0.15
40 0.16
41 0.17
42 0.19
43 0.26
44 0.27
45 0.31
46 0.36
47 0.31
48 0.31
49 0.35
50 0.34
51 0.28
52 0.26
53 0.22
54 0.18
55 0.17
56 0.16
57 0.11
58 0.09
59 0.1
60 0.1
61 0.14
62 0.14
63 0.14
64 0.16
65 0.16
66 0.15
67 0.14
68 0.14
69 0.11
70 0.1
71 0.09
72 0.08
73 0.08
74 0.1
75 0.11
76 0.14
77 0.17
78 0.2
79 0.23
80 0.27
81 0.28
82 0.31
83 0.37
84 0.37
85 0.38
86 0.42
87 0.39
88 0.39
89 0.42
90 0.37
91 0.31
92 0.31
93 0.32
94 0.3
95 0.32
96 0.36
97 0.42
98 0.51
99 0.55
100 0.64
101 0.69
102 0.74
103 0.79
104 0.83
105 0.83
106 0.83
107 0.89
108 0.89
109 0.9
110 0.85
111 0.86
112 0.82
113 0.83