Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LIP8

Protein Details
Accession A0A4Q9LIP8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-80NSDNDKCKPKDKCKIVSKNDCYEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MNYISFIVLIVLVVSKPECIGSKTCKTKECQTPSTGTIVVQASEPKCATKNTCESNNSDNDKCKPKDKCKIVSKNDCYEDIPLEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.08
5 0.09
6 0.11
7 0.15
8 0.22
9 0.31
10 0.4
11 0.44
12 0.46
13 0.5
14 0.57
15 0.62
16 0.63
17 0.58
18 0.52
19 0.52
20 0.48
21 0.47
22 0.38
23 0.27
24 0.23
25 0.19
26 0.16
27 0.12
28 0.14
29 0.11
30 0.13
31 0.13
32 0.11
33 0.12
34 0.13
35 0.15
36 0.18
37 0.25
38 0.28
39 0.34
40 0.35
41 0.38
42 0.41
43 0.46
44 0.46
45 0.42
46 0.41
47 0.41
48 0.48
49 0.47
50 0.51
51 0.53
52 0.58
53 0.66
54 0.7
55 0.75
56 0.77
57 0.85
58 0.87
59 0.88
60 0.85
61 0.84
62 0.79
63 0.71
64 0.62
65 0.54