Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LLF9

Protein Details
Accession A0A4Q9LLF9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
140-161TARNLHRHMKKYKYDPFRSFKEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 4, mito 3, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004932  Rer1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0016020  C:membrane  
GO:0051179  P:localization  
Pfam View protein in Pfam  
PF03248  Rer1  
Amino Acid Sequences MNIAILKTYFDRIVPMKRERWTFFGIVLFLFVLRIAIKRTHYLITYCLAIYLLHGLIGFCTPKEENIPDPFDNFEDDVYIPQTIDDDFKPFMRRLPEYSFWLMSIRLVMLALMGTFFGFLDIPVYAPILVVYFIVISFLTARNLHRHMKKYKYDPFRSFKEVYNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.45
4 0.5
5 0.57
6 0.56
7 0.57
8 0.53
9 0.47
10 0.42
11 0.38
12 0.32
13 0.25
14 0.22
15 0.16
16 0.11
17 0.1
18 0.07
19 0.06
20 0.06
21 0.07
22 0.09
23 0.12
24 0.14
25 0.17
26 0.2
27 0.21
28 0.22
29 0.22
30 0.22
31 0.2
32 0.19
33 0.16
34 0.14
35 0.12
36 0.1
37 0.09
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.05
47 0.08
48 0.08
49 0.08
50 0.12
51 0.13
52 0.16
53 0.2
54 0.25
55 0.23
56 0.23
57 0.23
58 0.21
59 0.2
60 0.17
61 0.13
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.06
68 0.06
69 0.06
70 0.05
71 0.07
72 0.06
73 0.08
74 0.08
75 0.1
76 0.13
77 0.13
78 0.15
79 0.18
80 0.2
81 0.22
82 0.28
83 0.3
84 0.32
85 0.34
86 0.31
87 0.28
88 0.27
89 0.22
90 0.16
91 0.13
92 0.09
93 0.06
94 0.05
95 0.05
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.05
119 0.04
120 0.04
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.1
127 0.12
128 0.14
129 0.2
130 0.25
131 0.33
132 0.39
133 0.47
134 0.53
135 0.61
136 0.68
137 0.72
138 0.77
139 0.79
140 0.82
141 0.83
142 0.81
143 0.79
144 0.77
145 0.7
146 0.67