Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9L3Q2

Protein Details
Accession A0A4Q9L3Q2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
174-202DILRDKFKTSPVRNKKKKGDKNVGGINTKHydrophilic
NLS Segment(s)
PositionSequence
101-114RKHKGKPIKLGKNK
153-193KENEKKDKNEDNEKKRVDKYRDILRDKFKTSPVRNKKKKGD
Subcellular Location(s) nucl 18, cyto_nucl 12.833, cyto 5.5, cyto_mito 4.666
Family & Domain DBs
Amino Acid Sequences MSVESLKISNNIFKGKNPSNTYLIDKNIRNINILRYLLKYTLFWLFSSIPFNIYCETQEDTNMRLSNLNDNPFIFGKEDKIRKMVIKDESSYDERDMEIIRKHKGKPIKLGKNKIIEKVIKEESSNDDGDMEIIRYINGKPIKFKRFVDKIVKENEKKDKNEDNEKKRVDKYRDILRDKFKTSPVRNKKKKGDKNVGGINTKTYYSLKYGTPNVGVSKVIYLYYIKRVLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.54
4 0.54
5 0.55
6 0.53
7 0.55
8 0.56
9 0.52
10 0.49
11 0.48
12 0.43
13 0.44
14 0.47
15 0.44
16 0.41
17 0.38
18 0.37
19 0.37
20 0.37
21 0.33
22 0.29
23 0.31
24 0.29
25 0.28
26 0.24
27 0.19
28 0.23
29 0.21
30 0.19
31 0.2
32 0.2
33 0.2
34 0.23
35 0.21
36 0.17
37 0.17
38 0.18
39 0.15
40 0.14
41 0.14
42 0.13
43 0.15
44 0.13
45 0.17
46 0.17
47 0.17
48 0.21
49 0.21
50 0.19
51 0.19
52 0.2
53 0.25
54 0.28
55 0.29
56 0.25
57 0.25
58 0.27
59 0.25
60 0.25
61 0.18
62 0.14
63 0.17
64 0.23
65 0.27
66 0.26
67 0.27
68 0.28
69 0.3
70 0.32
71 0.33
72 0.33
73 0.32
74 0.31
75 0.32
76 0.34
77 0.33
78 0.32
79 0.26
80 0.2
81 0.17
82 0.16
83 0.15
84 0.13
85 0.15
86 0.17
87 0.2
88 0.24
89 0.25
90 0.29
91 0.35
92 0.37
93 0.43
94 0.51
95 0.57
96 0.61
97 0.68
98 0.68
99 0.7
100 0.68
101 0.61
102 0.56
103 0.47
104 0.4
105 0.39
106 0.36
107 0.27
108 0.25
109 0.24
110 0.23
111 0.24
112 0.22
113 0.16
114 0.14
115 0.13
116 0.13
117 0.11
118 0.08
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.12
125 0.15
126 0.16
127 0.23
128 0.31
129 0.37
130 0.41
131 0.43
132 0.46
133 0.49
134 0.55
135 0.58
136 0.56
137 0.55
138 0.6
139 0.66
140 0.6
141 0.61
142 0.63
143 0.6
144 0.58
145 0.59
146 0.59
147 0.57
148 0.66
149 0.69
150 0.67
151 0.69
152 0.7
153 0.69
154 0.67
155 0.7
156 0.65
157 0.64
158 0.63
159 0.64
160 0.69
161 0.7
162 0.7
163 0.7
164 0.7
165 0.64
166 0.61
167 0.58
168 0.59
169 0.61
170 0.66
171 0.68
172 0.73
173 0.79
174 0.85
175 0.89
176 0.9
177 0.91
178 0.91
179 0.91
180 0.87
181 0.86
182 0.85
183 0.81
184 0.74
185 0.65
186 0.58
187 0.48
188 0.4
189 0.34
190 0.27
191 0.22
192 0.22
193 0.24
194 0.23
195 0.27
196 0.31
197 0.32
198 0.33
199 0.34
200 0.33
201 0.31
202 0.29
203 0.23
204 0.22
205 0.19
206 0.16
207 0.15
208 0.15
209 0.17
210 0.23