Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LHA6

Protein Details
Accession A0A4Q9LHA6    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
121-146EIINEVRNKKRNKKSIRISNKITVKNHydrophilic
NLS Segment(s)
PositionSequence
129-134KKRNKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSSNYGLCHVPLDQMDIFSHNCIMFEANTLYSNDESNRYNNLNESNDINEFDLIKESAGKDTFNGINETYGTNKTDGINETQVTEEFTSANESDNTTEFNCTNESNNKSITISNNESNFNEIINEVRNKKRNKKSIRISNKITVKNINIYSEKNSNIKPNANITEPLSLFTNYRRLFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.19
5 0.17
6 0.19
7 0.14
8 0.14
9 0.13
10 0.14
11 0.11
12 0.13
13 0.14
14 0.13
15 0.14
16 0.15
17 0.16
18 0.15
19 0.16
20 0.15
21 0.16
22 0.17
23 0.18
24 0.22
25 0.22
26 0.22
27 0.23
28 0.27
29 0.26
30 0.26
31 0.26
32 0.23
33 0.23
34 0.23
35 0.21
36 0.16
37 0.14
38 0.13
39 0.13
40 0.1
41 0.09
42 0.1
43 0.09
44 0.12
45 0.12
46 0.12
47 0.1
48 0.14
49 0.15
50 0.15
51 0.16
52 0.13
53 0.13
54 0.14
55 0.14
56 0.12
57 0.12
58 0.12
59 0.11
60 0.12
61 0.11
62 0.13
63 0.13
64 0.14
65 0.15
66 0.14
67 0.14
68 0.14
69 0.13
70 0.12
71 0.11
72 0.09
73 0.07
74 0.07
75 0.08
76 0.08
77 0.09
78 0.08
79 0.08
80 0.08
81 0.09
82 0.1
83 0.08
84 0.1
85 0.09
86 0.1
87 0.11
88 0.1
89 0.13
90 0.18
91 0.21
92 0.21
93 0.22
94 0.21
95 0.21
96 0.22
97 0.22
98 0.22
99 0.23
100 0.26
101 0.27
102 0.28
103 0.27
104 0.28
105 0.25
106 0.19
107 0.15
108 0.11
109 0.1
110 0.13
111 0.17
112 0.19
113 0.27
114 0.34
115 0.42
116 0.52
117 0.61
118 0.67
119 0.73
120 0.79
121 0.82
122 0.86
123 0.89
124 0.87
125 0.83
126 0.82
127 0.81
128 0.75
129 0.68
130 0.62
131 0.55
132 0.53
133 0.49
134 0.45
135 0.39
136 0.36
137 0.38
138 0.37
139 0.38
140 0.35
141 0.35
142 0.38
143 0.41
144 0.44
145 0.42
146 0.45
147 0.46
148 0.44
149 0.44
150 0.39
151 0.41
152 0.36
153 0.34
154 0.29
155 0.25
156 0.24
157 0.25
158 0.32