Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KQV3

Protein Details
Accession A0A4Q9KQV3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-34LKGNMKKWLENIKKKYKKKYKNRKLLFISDKGYHydrophilic
NLS Segment(s)
PositionSequence
12-25NIKKKYKKKYKNRK
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, mito 9, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Amino Acid Sequences MLKGNMKKWLENIKKKYKKKYKNRKLLFISDKGYIECIVYSNKEYKVRMSVYEYLLIEILIEKGSIKVEEYIIKGGSDVGDVSVLDNSNNIKDILDSNNIKDILDSNNIKDNRDTKDNKNTKDTNNLHTTNTTNNTNTTNNNTTNNTNNTPNNILFLLRYSVLDNLCCYNLIVIIEGVIYLNNNFKSEKEKIKFKKLNIISNKGYDSNGYGYDSSGYGYGNGYDNGYGSNPYISKYIDTNTINTNTINTNVNNTNNINNVYVQCFVVSVMKREKRLSVNCLKDKVISKVGCSVSKVEEIIGVLVEKGIIEKYGEEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.91
4 0.91
5 0.91
6 0.92
7 0.93
8 0.93
9 0.94
10 0.94
11 0.93
12 0.9
13 0.89
14 0.86
15 0.81
16 0.73
17 0.67
18 0.59
19 0.49
20 0.42
21 0.32
22 0.24
23 0.18
24 0.16
25 0.15
26 0.16
27 0.18
28 0.22
29 0.27
30 0.31
31 0.32
32 0.34
33 0.38
34 0.38
35 0.38
36 0.39
37 0.39
38 0.36
39 0.4
40 0.37
41 0.3
42 0.28
43 0.24
44 0.18
45 0.13
46 0.11
47 0.06
48 0.06
49 0.05
50 0.06
51 0.07
52 0.07
53 0.08
54 0.09
55 0.11
56 0.14
57 0.15
58 0.17
59 0.16
60 0.16
61 0.15
62 0.14
63 0.12
64 0.09
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.09
76 0.1
77 0.09
78 0.08
79 0.09
80 0.11
81 0.13
82 0.19
83 0.2
84 0.2
85 0.24
86 0.24
87 0.23
88 0.21
89 0.2
90 0.16
91 0.22
92 0.22
93 0.19
94 0.26
95 0.27
96 0.28
97 0.29
98 0.3
99 0.28
100 0.36
101 0.39
102 0.38
103 0.48
104 0.55
105 0.55
106 0.59
107 0.59
108 0.53
109 0.59
110 0.56
111 0.51
112 0.51
113 0.49
114 0.42
115 0.39
116 0.37
117 0.31
118 0.31
119 0.27
120 0.2
121 0.2
122 0.22
123 0.22
124 0.23
125 0.24
126 0.25
127 0.25
128 0.27
129 0.28
130 0.26
131 0.29
132 0.32
133 0.29
134 0.28
135 0.27
136 0.27
137 0.27
138 0.25
139 0.22
140 0.18
141 0.16
142 0.12
143 0.12
144 0.1
145 0.08
146 0.08
147 0.08
148 0.09
149 0.09
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.06
157 0.06
158 0.06
159 0.06
160 0.05
161 0.04
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.06
169 0.07
170 0.08
171 0.08
172 0.09
173 0.15
174 0.2
175 0.29
176 0.31
177 0.41
178 0.45
179 0.56
180 0.61
181 0.57
182 0.62
183 0.58
184 0.63
185 0.6
186 0.61
187 0.53
188 0.5
189 0.5
190 0.41
191 0.36
192 0.27
193 0.22
194 0.17
195 0.15
196 0.14
197 0.12
198 0.11
199 0.12
200 0.11
201 0.1
202 0.08
203 0.07
204 0.06
205 0.06
206 0.07
207 0.08
208 0.08
209 0.08
210 0.08
211 0.08
212 0.08
213 0.08
214 0.08
215 0.07
216 0.09
217 0.09
218 0.1
219 0.12
220 0.12
221 0.13
222 0.14
223 0.15
224 0.2
225 0.21
226 0.21
227 0.24
228 0.26
229 0.26
230 0.24
231 0.24
232 0.18
233 0.19
234 0.21
235 0.17
236 0.19
237 0.22
238 0.24
239 0.26
240 0.26
241 0.27
242 0.26
243 0.28
244 0.24
245 0.22
246 0.22
247 0.2
248 0.2
249 0.18
250 0.15
251 0.13
252 0.12
253 0.17
254 0.17
255 0.2
256 0.29
257 0.34
258 0.38
259 0.4
260 0.45
261 0.48
262 0.53
263 0.57
264 0.57
265 0.62
266 0.65
267 0.67
268 0.62
269 0.59
270 0.57
271 0.54
272 0.53
273 0.44
274 0.4
275 0.44
276 0.47
277 0.43
278 0.41
279 0.38
280 0.32
281 0.34
282 0.32
283 0.24
284 0.21
285 0.19
286 0.17
287 0.15
288 0.12
289 0.09
290 0.08
291 0.08
292 0.06
293 0.07
294 0.07
295 0.07
296 0.07