Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LGG4

Protein Details
Accession A0A4Q9LGG4    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MLGKRTNSKERKSKLGNRKLRYGKKKQRKKLITHLKRVSKEBasic
59-78ECNSCRKNNWVKKEGREKKIHydrophilic
NLS Segment(s)
PositionSequence
5-36RTNSKERKSKLGNRKLRYGKKKQRKKLITHLK
70-84KKEGREKKIGIGKIK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MLGKRTNSKERKSKLGNRKLRYGKKKQRKKLITHLKRVSKEENENCLRKYFFIKKKIGECNSCRKNNWVKKEGREKKIGIGKIKDYGRVEKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.84
4 0.78
5 0.83
6 0.83
7 0.84
8 0.84
9 0.84
10 0.84
11 0.86
12 0.91
13 0.91
14 0.91
15 0.9
16 0.88
17 0.87
18 0.88
19 0.86
20 0.86
21 0.85
22 0.82
23 0.76
24 0.73
25 0.67
26 0.61
27 0.61
28 0.55
29 0.55
30 0.52
31 0.5
32 0.47
33 0.43
34 0.37
35 0.29
36 0.31
37 0.33
38 0.35
39 0.41
40 0.45
41 0.48
42 0.55
43 0.63
44 0.62
45 0.6
46 0.57
47 0.6
48 0.64
49 0.64
50 0.58
51 0.57
52 0.62
53 0.63
54 0.67
55 0.65
56 0.64
57 0.68
58 0.78
59 0.81
60 0.77
61 0.75
62 0.67
63 0.67
64 0.68
65 0.65
66 0.61
67 0.57
68 0.54
69 0.55
70 0.55
71 0.54
72 0.49