Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LIF3

Protein Details
Accession A0A4Q9LIF3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-128RYVYKRCLIKHMKQKHKKHLPRNHSILFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MIFDKYDYNDDLSLFMNFLSKIHSQERNSRSNNHQETKNYVTKKYFNSYSVGNNNTEIQNKMNLERKNNFKVNFVPNISYSNYIPIPYDNDKFLCRYCNIRYVYKRCLIKHMKQKHKKHLPRNHSILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.1
5 0.1
6 0.13
7 0.13
8 0.17
9 0.23
10 0.3
11 0.32
12 0.42
13 0.48
14 0.53
15 0.54
16 0.56
17 0.56
18 0.6
19 0.64
20 0.6
21 0.59
22 0.53
23 0.56
24 0.57
25 0.58
26 0.5
27 0.45
28 0.44
29 0.44
30 0.46
31 0.45
32 0.41
33 0.35
34 0.34
35 0.33
36 0.35
37 0.35
38 0.32
39 0.27
40 0.25
41 0.25
42 0.24
43 0.24
44 0.18
45 0.14
46 0.15
47 0.15
48 0.17
49 0.23
50 0.23
51 0.27
52 0.31
53 0.36
54 0.4
55 0.45
56 0.43
57 0.38
58 0.42
59 0.41
60 0.41
61 0.36
62 0.31
63 0.27
64 0.28
65 0.27
66 0.23
67 0.19
68 0.17
69 0.16
70 0.15
71 0.14
72 0.13
73 0.17
74 0.19
75 0.21
76 0.19
77 0.21
78 0.22
79 0.23
80 0.24
81 0.22
82 0.2
83 0.25
84 0.26
85 0.32
86 0.35
87 0.42
88 0.5
89 0.53
90 0.58
91 0.59
92 0.63
93 0.56
94 0.63
95 0.63
96 0.63
97 0.67
98 0.71
99 0.75
100 0.79
101 0.87
102 0.88
103 0.91
104 0.92
105 0.92
106 0.92
107 0.91
108 0.91