Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LCL0

Protein Details
Accession A0A4Q9LCL0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-49DVYTRFCKKRGQKAIHICGTDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, cyto_mito 9, mito 7.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001412  aa-tRNA-synth_I_CS  
IPR023458  Met-tRNA_ligase_1  
IPR015413  Methionyl/Leucyl_tRNA_Synth  
IPR033911  MetRS_core  
IPR029038  MetRS_Zn  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004825  F:methionine-tRNA ligase activity  
GO:0006431  P:methionyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF09334  tRNA-synt_1g  
PROSITE View protein in PROSITE  
PS00178  AA_TRNA_LIGASE_I  
Amino Acid Sequences MKKLITSALPYVNNLPHLGNIVGCVLSADVYTRFCKKRGQKAIHICGTDEYGTATEMTAIEQNLHPKEIVDKNSVIHKNIYDWFEIHFDHFGRTTDDDHVIFTQKIFKEIYRENYFEEKTSEQYFCLKCELFLADRYLLGTCPSCSSERARGDQCDDCGYLVKALELKLPKCSICKEEPVIRKTKHLYLRLDLLKPQIKKFIEEKSESWSDNAKAIANHWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.19
4 0.21
5 0.19
6 0.15
7 0.13
8 0.12
9 0.11
10 0.1
11 0.09
12 0.07
13 0.06
14 0.06
15 0.07
16 0.08
17 0.1
18 0.14
19 0.21
20 0.23
21 0.25
22 0.35
23 0.42
24 0.52
25 0.6
26 0.65
27 0.68
28 0.76
29 0.84
30 0.81
31 0.72
32 0.62
33 0.52
34 0.46
35 0.36
36 0.26
37 0.17
38 0.11
39 0.11
40 0.1
41 0.09
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.09
48 0.1
49 0.15
50 0.16
51 0.16
52 0.15
53 0.14
54 0.2
55 0.24
56 0.26
57 0.25
58 0.24
59 0.25
60 0.34
61 0.35
62 0.31
63 0.27
64 0.24
65 0.23
66 0.27
67 0.27
68 0.19
69 0.18
70 0.18
71 0.18
72 0.18
73 0.15
74 0.13
75 0.12
76 0.12
77 0.13
78 0.12
79 0.12
80 0.13
81 0.14
82 0.14
83 0.16
84 0.15
85 0.15
86 0.15
87 0.14
88 0.13
89 0.11
90 0.15
91 0.13
92 0.15
93 0.15
94 0.14
95 0.18
96 0.21
97 0.28
98 0.27
99 0.28
100 0.29
101 0.32
102 0.32
103 0.28
104 0.27
105 0.21
106 0.19
107 0.21
108 0.19
109 0.15
110 0.21
111 0.2
112 0.19
113 0.21
114 0.18
115 0.16
116 0.17
117 0.18
118 0.13
119 0.14
120 0.16
121 0.13
122 0.13
123 0.14
124 0.13
125 0.11
126 0.11
127 0.1
128 0.08
129 0.09
130 0.11
131 0.12
132 0.14
133 0.18
134 0.25
135 0.28
136 0.33
137 0.34
138 0.35
139 0.38
140 0.39
141 0.36
142 0.31
143 0.28
144 0.23
145 0.21
146 0.2
147 0.16
148 0.13
149 0.12
150 0.11
151 0.11
152 0.15
153 0.18
154 0.18
155 0.22
156 0.24
157 0.25
158 0.26
159 0.29
160 0.31
161 0.3
162 0.36
163 0.37
164 0.44
165 0.51
166 0.53
167 0.59
168 0.54
169 0.57
170 0.56
171 0.58
172 0.58
173 0.57
174 0.56
175 0.52
176 0.6
177 0.58
178 0.56
179 0.5
180 0.49
181 0.49
182 0.47
183 0.46
184 0.45
185 0.41
186 0.43
187 0.46
188 0.47
189 0.48
190 0.5
191 0.48
192 0.47
193 0.5
194 0.46
195 0.44
196 0.4
197 0.33
198 0.32
199 0.32
200 0.27
201 0.23