Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LAX2

Protein Details
Accession A0A4Q9LAX2   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-37IFDTSKKIYTKKNNKKFYKRVVPRSVDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
Amino Acid Sequences MSKNVLKNEIFDTSKKIYTKKNNKKFYKRVVPRSVDAPASEIIRYGLNNENAAKSMEKNNTMIFICDNRATKPQIKKAVEELYGTSVSKVRTLNTIQGAKKAYVRMVEPGEALRVASKAGIME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.39
4 0.42
5 0.51
6 0.61
7 0.66
8 0.72
9 0.77
10 0.85
11 0.91
12 0.91
13 0.91
14 0.9
15 0.89
16 0.89
17 0.88
18 0.83
19 0.74
20 0.68
21 0.6
22 0.5
23 0.4
24 0.32
25 0.23
26 0.19
27 0.17
28 0.13
29 0.11
30 0.1
31 0.1
32 0.11
33 0.15
34 0.15
35 0.16
36 0.17
37 0.16
38 0.16
39 0.18
40 0.15
41 0.12
42 0.16
43 0.17
44 0.18
45 0.19
46 0.18
47 0.19
48 0.19
49 0.18
50 0.13
51 0.11
52 0.12
53 0.13
54 0.14
55 0.14
56 0.17
57 0.2
58 0.26
59 0.32
60 0.38
61 0.45
62 0.45
63 0.46
64 0.48
65 0.49
66 0.44
67 0.38
68 0.31
69 0.25
70 0.24
71 0.22
72 0.18
73 0.15
74 0.14
75 0.16
76 0.16
77 0.14
78 0.17
79 0.19
80 0.24
81 0.29
82 0.35
83 0.33
84 0.37
85 0.39
86 0.36
87 0.37
88 0.34
89 0.29
90 0.25
91 0.26
92 0.27
93 0.27
94 0.27
95 0.24
96 0.23
97 0.22
98 0.2
99 0.18
100 0.14
101 0.11
102 0.11
103 0.1