Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KRI0

Protein Details
Accession A0A4Q9KRI0   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MLYYYKEDKKKLFKNKELNISLIHydrophilic
374-394IEEYNKRRRDSKDKEDSKDKEBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.833, cyto_mito 4.666, cyto 4.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019474  Ub_conjug_fac_E4_core  
IPR045132  UBE4  
IPR003613  Ubox_domain  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016020  C:membrane  
GO:0000151  C:ubiquitin ligase complex  
GO:0034450  F:ubiquitin-ubiquitin ligase activity  
GO:0016567  P:protein ubiquitination  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
Pfam View protein in Pfam  
PF04564  U-box  
PF10408  Ufd2P_core  
Amino Acid Sequences MLYYYKEDKKKLFKNKELNISLINLYNSINRMEQTFYDKYSVRYYISRILREEEYYDVGVRFVSYMIGDLEHLLCEGFNAIISIKRSEGNSSVVGGVDGNSGGGNSGGGSNISSNSGGGSSNISSSNISNNNNIPSTNNTNNPSTTNPSSTNNNPSITNNNTNNNNTRDTFVARSCFVYALECLYFILFLIRRNKRVFSKEEVLNRFVININSNLKTIVGPKCSTLKVKNAEKYNFKPKEMLRILSLIYIEMDTLNFIESIVSDRMYFNMSLINRCYFICNEKYILSEIELEKMKKNIEKMEKCVVVEDEDVPEDIMDPLTCSAICLPVKLVTSGVTVDRSTFELLLLDGVDPFNRERLDESKGVVDEEMLRRIEEYNKRRRDSKDKEDSKDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.89
4 0.81
5 0.74
6 0.65
7 0.58
8 0.5
9 0.42
10 0.34
11 0.24
12 0.22
13 0.21
14 0.2
15 0.19
16 0.19
17 0.16
18 0.17
19 0.19
20 0.2
21 0.24
22 0.26
23 0.26
24 0.29
25 0.3
26 0.31
27 0.34
28 0.35
29 0.3
30 0.3
31 0.32
32 0.37
33 0.42
34 0.43
35 0.4
36 0.42
37 0.41
38 0.4
39 0.38
40 0.32
41 0.28
42 0.25
43 0.24
44 0.2
45 0.17
46 0.15
47 0.13
48 0.11
49 0.08
50 0.07
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.04
66 0.05
67 0.05
68 0.09
69 0.11
70 0.12
71 0.13
72 0.15
73 0.16
74 0.18
75 0.2
76 0.2
77 0.19
78 0.19
79 0.18
80 0.16
81 0.15
82 0.12
83 0.11
84 0.08
85 0.06
86 0.05
87 0.05
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.09
109 0.1
110 0.1
111 0.1
112 0.11
113 0.16
114 0.19
115 0.2
116 0.21
117 0.23
118 0.25
119 0.25
120 0.24
121 0.2
122 0.21
123 0.27
124 0.28
125 0.31
126 0.31
127 0.32
128 0.33
129 0.34
130 0.31
131 0.3
132 0.28
133 0.27
134 0.27
135 0.28
136 0.32
137 0.33
138 0.37
139 0.33
140 0.32
141 0.3
142 0.29
143 0.32
144 0.32
145 0.36
146 0.33
147 0.35
148 0.37
149 0.39
150 0.42
151 0.4
152 0.38
153 0.31
154 0.29
155 0.26
156 0.25
157 0.24
158 0.21
159 0.2
160 0.18
161 0.18
162 0.17
163 0.16
164 0.14
165 0.12
166 0.1
167 0.1
168 0.09
169 0.08
170 0.07
171 0.07
172 0.06
173 0.05
174 0.07
175 0.06
176 0.11
177 0.2
178 0.22
179 0.27
180 0.29
181 0.33
182 0.36
183 0.4
184 0.4
185 0.38
186 0.42
187 0.43
188 0.49
189 0.48
190 0.45
191 0.4
192 0.36
193 0.3
194 0.24
195 0.2
196 0.14
197 0.13
198 0.15
199 0.15
200 0.15
201 0.14
202 0.14
203 0.13
204 0.17
205 0.18
206 0.18
207 0.18
208 0.19
209 0.22
210 0.24
211 0.28
212 0.26
213 0.29
214 0.34
215 0.41
216 0.45
217 0.49
218 0.53
219 0.56
220 0.59
221 0.62
222 0.58
223 0.51
224 0.52
225 0.45
226 0.51
227 0.47
228 0.42
229 0.33
230 0.3
231 0.3
232 0.25
233 0.24
234 0.13
235 0.11
236 0.09
237 0.07
238 0.06
239 0.05
240 0.04
241 0.04
242 0.05
243 0.04
244 0.04
245 0.04
246 0.04
247 0.08
248 0.08
249 0.09
250 0.09
251 0.09
252 0.1
253 0.12
254 0.12
255 0.08
256 0.12
257 0.13
258 0.15
259 0.17
260 0.18
261 0.17
262 0.18
263 0.2
264 0.16
265 0.21
266 0.21
267 0.21
268 0.22
269 0.22
270 0.23
271 0.22
272 0.21
273 0.17
274 0.19
275 0.17
276 0.19
277 0.22
278 0.22
279 0.22
280 0.24
281 0.26
282 0.24
283 0.28
284 0.32
285 0.39
286 0.43
287 0.47
288 0.53
289 0.53
290 0.5
291 0.49
292 0.41
293 0.33
294 0.29
295 0.24
296 0.17
297 0.15
298 0.15
299 0.13
300 0.12
301 0.1
302 0.09
303 0.08
304 0.06
305 0.07
306 0.07
307 0.08
308 0.08
309 0.08
310 0.08
311 0.14
312 0.14
313 0.14
314 0.15
315 0.18
316 0.19
317 0.19
318 0.19
319 0.14
320 0.15
321 0.16
322 0.16
323 0.14
324 0.13
325 0.14
326 0.14
327 0.15
328 0.16
329 0.14
330 0.13
331 0.11
332 0.11
333 0.11
334 0.1
335 0.08
336 0.07
337 0.08
338 0.08
339 0.09
340 0.1
341 0.14
342 0.14
343 0.14
344 0.18
345 0.21
346 0.26
347 0.27
348 0.28
349 0.29
350 0.29
351 0.29
352 0.25
353 0.23
354 0.24
355 0.25
356 0.28
357 0.23
358 0.22
359 0.22
360 0.25
361 0.32
362 0.36
363 0.43
364 0.49
365 0.58
366 0.63
367 0.69
368 0.76
369 0.78
370 0.78
371 0.79
372 0.8
373 0.8
374 0.84