Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9LMB4

Protein Details
Accession A0A4Q9LMB4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-66VQSNNKSKGKEKNINEKKRRNNVKKTVEKRKKIKKRKKEIKRKTVIEKEIIBasic
NLS Segment(s)
PositionSequence
21-71KSKGKEKNINEKKRRNNVKKTVEKRKKIKKRKKEIKRKTVIEKEIIIKKKG
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MKFFIQHTNSLTFKLVQSNNKSKGKEKNINEKKRRNNVKKTVEKRKKIKKRKKEIKRKTVIEKEIIIKKKGNEREYKEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.41
5 0.48
6 0.55
7 0.59
8 0.61
9 0.59
10 0.64
11 0.66
12 0.66
13 0.64
14 0.67
15 0.72
16 0.8
17 0.84
18 0.83
19 0.83
20 0.84
21 0.88
22 0.86
23 0.86
24 0.85
25 0.86
26 0.87
27 0.86
28 0.87
29 0.86
30 0.85
31 0.85
32 0.86
33 0.86
34 0.87
35 0.89
36 0.89
37 0.91
38 0.93
39 0.94
40 0.95
41 0.95
42 0.95
43 0.94
44 0.91
45 0.89
46 0.88
47 0.82
48 0.75
49 0.68
50 0.64
51 0.62
52 0.59
53 0.52
54 0.46
55 0.46
56 0.51
57 0.56
58 0.57
59 0.58
60 0.62