Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LIU7

Protein Details
Accession A0A4Q9LIU7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-86WFEKMKERRNSEKNKKKLKKEEKKQKKEEMKKQKDEIKEBasic
NLS Segment(s)
PositionSequence
27-111DKTSEKKAANKSGKKEEKSKSWFEKMKERRNSEKNKKKLKKEEKKQKKEEMKKQKDEIKENPKIYRPNKKDDIDIIKDDKKAKKK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MITMCESIFTFSFFGKKKENIQNSEKDKTSEKKAANKSGKKEEKSKSWFEKMKERRNSEKNKKKLKKEEKKQKKEEMKKQKDEIKENPKIYRPNKKDDIDIIKDDKKAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.31
4 0.39
5 0.48
6 0.56
7 0.56
8 0.61
9 0.66
10 0.67
11 0.69
12 0.61
13 0.53
14 0.51
15 0.49
16 0.49
17 0.47
18 0.46
19 0.49
20 0.55
21 0.63
22 0.67
23 0.69
24 0.68
25 0.71
26 0.74
27 0.68
28 0.7
29 0.64
30 0.64
31 0.63
32 0.65
33 0.61
34 0.61
35 0.62
36 0.56
37 0.61
38 0.61
39 0.65
40 0.66
41 0.65
42 0.66
43 0.7
44 0.78
45 0.79
46 0.79
47 0.79
48 0.82
49 0.84
50 0.85
51 0.87
52 0.88
53 0.88
54 0.89
55 0.91
56 0.91
57 0.93
58 0.92
59 0.91
60 0.91
61 0.9
62 0.9
63 0.9
64 0.89
65 0.86
66 0.85
67 0.82
68 0.79
69 0.76
70 0.75
71 0.74
72 0.72
73 0.69
74 0.67
75 0.66
76 0.68
77 0.68
78 0.7
79 0.65
80 0.65
81 0.7
82 0.67
83 0.65
84 0.64
85 0.65
86 0.6
87 0.6
88 0.57
89 0.53
90 0.55
91 0.57