Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KX03

Protein Details
Accession A0A4Q9KX03   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
42-63IKSIDKERKKLNQNTFEKKNKCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003107  HAT  
IPR045075  Syf1-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF02184  HAT  
Amino Acid Sequences MNHKAPLFMDITNQYKKEKIEKFLKVKNKEISEKQISVDEIIKSIDKERKKLNQNTFEKKNKCAIKNLNLQQRNKYEALICKYRKDPGVYIKYANLEENFEEYYKARSVYERAIDFNYSVDTLWFKYIDFELRNNFLNHARNLFERFIELHPGNEKAWLKYINFEKSKKENENVRRIFKMWINKITNENN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.39
4 0.44
5 0.44
6 0.47
7 0.52
8 0.6
9 0.66
10 0.71
11 0.78
12 0.74
13 0.76
14 0.75
15 0.73
16 0.71
17 0.68
18 0.68
19 0.66
20 0.61
21 0.54
22 0.49
23 0.42
24 0.36
25 0.34
26 0.25
27 0.18
28 0.18
29 0.17
30 0.15
31 0.2
32 0.24
33 0.24
34 0.28
35 0.36
36 0.44
37 0.53
38 0.61
39 0.66
40 0.7
41 0.75
42 0.8
43 0.81
44 0.82
45 0.75
46 0.69
47 0.67
48 0.65
49 0.58
50 0.58
51 0.56
52 0.55
53 0.62
54 0.66
55 0.67
56 0.66
57 0.65
58 0.63
59 0.59
60 0.55
61 0.46
62 0.39
63 0.33
64 0.32
65 0.35
66 0.37
67 0.35
68 0.34
69 0.35
70 0.38
71 0.37
72 0.34
73 0.32
74 0.33
75 0.38
76 0.36
77 0.35
78 0.33
79 0.32
80 0.3
81 0.27
82 0.18
83 0.13
84 0.12
85 0.12
86 0.11
87 0.1
88 0.1
89 0.09
90 0.11
91 0.11
92 0.11
93 0.1
94 0.11
95 0.13
96 0.16
97 0.2
98 0.18
99 0.19
100 0.2
101 0.2
102 0.19
103 0.17
104 0.14
105 0.1
106 0.09
107 0.08
108 0.07
109 0.08
110 0.09
111 0.08
112 0.08
113 0.09
114 0.1
115 0.14
116 0.15
117 0.17
118 0.19
119 0.21
120 0.24
121 0.23
122 0.24
123 0.24
124 0.28
125 0.27
126 0.26
127 0.26
128 0.25
129 0.29
130 0.28
131 0.23
132 0.2
133 0.21
134 0.2
135 0.25
136 0.23
137 0.22
138 0.23
139 0.25
140 0.24
141 0.28
142 0.28
143 0.23
144 0.28
145 0.28
146 0.26
147 0.31
148 0.38
149 0.41
150 0.45
151 0.47
152 0.49
153 0.54
154 0.63
155 0.62
156 0.63
157 0.64
158 0.67
159 0.76
160 0.76
161 0.74
162 0.69
163 0.64
164 0.61
165 0.57
166 0.58
167 0.55
168 0.57
169 0.56
170 0.56