Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KVB6

Protein Details
Accession A0A4Q9KVB6   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSHKKLLPFKNYKKSKIGKNIKYRGSKHHydrophilic
NLS Segment(s)
PositionSequence
13-19KKSKIGK
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MSHKKLLPFKNYKKSKIGKNIKYRGSKHLLKQLQEEGAEYLFMINQITNKPLKKICDITGLPSNYTCPRTNLNYYNGEVYEYIRNIRPEIVQQYLDIKNSGKEMKMFKKTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.8
4 0.8
5 0.79
6 0.82
7 0.85
8 0.83
9 0.85
10 0.78
11 0.75
12 0.73
13 0.69
14 0.64
15 0.65
16 0.62
17 0.55
18 0.55
19 0.51
20 0.45
21 0.39
22 0.34
23 0.24
24 0.19
25 0.17
26 0.12
27 0.09
28 0.06
29 0.06
30 0.05
31 0.04
32 0.05
33 0.06
34 0.08
35 0.12
36 0.13
37 0.16
38 0.18
39 0.2
40 0.23
41 0.26
42 0.25
43 0.3
44 0.29
45 0.3
46 0.34
47 0.32
48 0.28
49 0.25
50 0.26
51 0.21
52 0.24
53 0.22
54 0.17
55 0.2
56 0.25
57 0.31
58 0.33
59 0.35
60 0.35
61 0.35
62 0.35
63 0.31
64 0.27
65 0.22
66 0.19
67 0.19
68 0.16
69 0.17
70 0.19
71 0.2
72 0.19
73 0.21
74 0.2
75 0.21
76 0.25
77 0.27
78 0.24
79 0.23
80 0.29
81 0.29
82 0.29
83 0.25
84 0.22
85 0.2
86 0.24
87 0.26
88 0.22
89 0.25
90 0.32
91 0.4