Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9KTA0

Protein Details
Accession A0A4Q9KTA0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ILSCKPCFFNKKIKKTPFKVNRNTNDDTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MILSCKPCFFNKKIKKTPFKVNRNTNDDTYMKFDTVDDDISFISHEEKNVGSLCNKCNDGRALYHDGVCTNEYKGKSYNLQDKSTQKALSTIYEEKEFKDKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.81
4 0.88
5 0.87
6 0.87
7 0.86
8 0.86
9 0.85
10 0.81
11 0.79
12 0.69
13 0.64
14 0.55
15 0.47
16 0.41
17 0.34
18 0.26
19 0.22
20 0.2
21 0.16
22 0.16
23 0.16
24 0.11
25 0.1
26 0.09
27 0.09
28 0.09
29 0.08
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.1
37 0.11
38 0.1
39 0.12
40 0.14
41 0.16
42 0.17
43 0.16
44 0.18
45 0.19
46 0.19
47 0.18
48 0.22
49 0.25
50 0.24
51 0.25
52 0.23
53 0.21
54 0.21
55 0.2
56 0.16
57 0.12
58 0.16
59 0.15
60 0.17
61 0.19
62 0.21
63 0.26
64 0.32
65 0.39
66 0.4
67 0.43
68 0.47
69 0.49
70 0.53
71 0.53
72 0.47
73 0.38
74 0.36
75 0.35
76 0.32
77 0.34
78 0.32
79 0.29
80 0.35
81 0.35
82 0.34