FuNGI

A0A4Q9LGQ9

Protein Details

Accession

A0A4Q9LGQ9

Localization Confidence

Low

Confidence Score

8.9

NoLS Segment(s)

Position	Sequence	Protein Nature
410-430	FLNLCDRFKDKKNNLSHKINL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011989 ARM-like IPR016024 ARM-type_fold IPR034085 TOG IPR045110 XMAP215
Gene Ontology	GO:0043232 C:intracellular non-membrane-bounded organelle GO:0099080 C:supramolecular complex GO:0061863 F:microtubule plus end polymerase GO:0051010 F:microtubule plus-end binding GO:0030951 P:establishment or maintenance of microtubule cytoskeleton polarity GO:0046785 P:microtubule polymerization GO:0007051 P:spindle organization

Amino Acid Sequences

MTEADSPTLKNLKSTDWKIRLQTYQSLQPHEISPEIIKTLTKETTVPVLEAGVSILLIYKPSYLYPHIVPLFCNLCTSKVSLKSKILEIFFYILNNLSKEVLFDLFIFLENKNPKLVCSVIVLIKDVTKQYGVIYNVEGVNLSNLLQHSDSSVRKEAMVLIIEIYKTYKERVLIYIKGVKPIILKNLEEEFLKIREMSKKEGFKDKGSKLEGVSDKGCKLEGVSDCIDKQQGVSYSTHEQQGVSNSIHKQQGVSNSIHKQHPVNNSADTYHPISDSTDIQYPVNNCTDTYHPFNNSTDTYHPLNNNIPQQHPVTETPNKQHPFNNTPNKQHPVKLDEGCYDMVKSMDWKERKMGVEEIYKYLKSGGVNEGKVVGVLSKMVSDINIQVLLTVLDTLLLLEKRDFQSRKDFFLNLCDRFKDKKNNLSHKINLVLERAEA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.54
3	0.55
4	0.61
5	0.63
6	0.67
7	0.66
8	0.61
9	0.62
10	0.56
11	0.59
12	0.58
13	0.58
14	0.53
15	0.48
16	0.46
17	0.4
18	0.35
19	0.28
20	0.25
21	0.21
22	0.21
23	0.19
24	0.18
25	0.18
26	0.22
27	0.22
28	0.21
29	0.2
30	0.21
31	0.27
32	0.27
33	0.25
34	0.19
35	0.18
36	0.17
37	0.16
38	0.14
39	0.07
40	0.06
41	0.05
42	0.06
43	0.05
44	0.06
45	0.06
46	0.07
47	0.08
48	0.09
49	0.13
50	0.15
51	0.18
52	0.19
53	0.27
54	0.3
55	0.29
56	0.29
57	0.31
58	0.31
59	0.27
60	0.29
61	0.22
62	0.2
63	0.21
64	0.24
65	0.25
66	0.31
67	0.37
68	0.39
69	0.43
70	0.44
71	0.48
72	0.5
73	0.45
74	0.36
75	0.33
76	0.29
77	0.24
78	0.22
79	0.17
80	0.15
81	0.15
82	0.15
83	0.14
84	0.12
85	0.12
86	0.12
87	0.13
88	0.11
89	0.1
90	0.1
91	0.1
92	0.09
93	0.11
94	0.12
95	0.1
96	0.17
97	0.19
98	0.19
99	0.21
100	0.21
101	0.2
102	0.22
103	0.23
104	0.17
105	0.18
106	0.2
107	0.19
108	0.19
109	0.2
110	0.17
111	0.17
112	0.17
113	0.15
114	0.13
115	0.11
116	0.11
117	0.11
118	0.16
119	0.16
120	0.15
121	0.16
122	0.17
123	0.16
124	0.16
125	0.15
126	0.09
127	0.08
128	0.08
129	0.07
130	0.07
131	0.07
132	0.08
133	0.08
134	0.08
135	0.1
136	0.14
137	0.16
138	0.18
139	0.21
140	0.2
141	0.2
142	0.2
143	0.19
144	0.16
145	0.16
146	0.12
147	0.1
148	0.1
149	0.1
150	0.1
151	0.09
152	0.08
153	0.08
154	0.09
155	0.1
156	0.11
157	0.13
158	0.18
159	0.22
160	0.23
161	0.26
162	0.32
163	0.31
164	0.32
165	0.31
166	0.27
167	0.25
168	0.25
169	0.27
170	0.22
171	0.22
172	0.21
173	0.23
174	0.22
175	0.2
176	0.19
177	0.15
178	0.13
179	0.13
180	0.11
181	0.12
182	0.17
183	0.19
184	0.24
185	0.29
186	0.33
187	0.35
188	0.44
189	0.44
190	0.44
191	0.5
192	0.47
193	0.47
194	0.45
195	0.43
196	0.34
197	0.39
198	0.34
199	0.28
200	0.28
201	0.22
202	0.21
203	0.19
204	0.19
205	0.12
206	0.1
207	0.13
208	0.12
209	0.14
210	0.15
211	0.16
212	0.16
213	0.17
214	0.17
215	0.12
216	0.11
217	0.1
218	0.1
219	0.12
220	0.12
221	0.15
222	0.18
223	0.19
224	0.21
225	0.18
226	0.16
227	0.15
228	0.18
229	0.18
230	0.15
231	0.17
232	0.16
233	0.2
234	0.21
235	0.2
236	0.18
237	0.18
238	0.24
239	0.24
240	0.24
241	0.26
242	0.29
243	0.33
244	0.33
245	0.32
246	0.28
247	0.31
248	0.36
249	0.34
250	0.32
251	0.3
252	0.3
253	0.29
254	0.28
255	0.25
256	0.2
257	0.17
258	0.15
259	0.13
260	0.13
261	0.14
262	0.14
263	0.14
264	0.15
265	0.15
266	0.15
267	0.17
268	0.18
269	0.19
270	0.2
271	0.18
272	0.14
273	0.16
274	0.19
275	0.21
276	0.25
277	0.26
278	0.25
279	0.27
280	0.28
281	0.29
282	0.27
283	0.26
284	0.23
285	0.23
286	0.24
287	0.25
288	0.25
289	0.25
290	0.28
291	0.3
292	0.34
293	0.32
294	0.31
295	0.3
296	0.31
297	0.3
298	0.29
299	0.27
300	0.28
301	0.33
302	0.35
303	0.38
304	0.45
305	0.46
306	0.45
307	0.46
308	0.47
309	0.48
310	0.55
311	0.6
312	0.58
313	0.64
314	0.69
315	0.71
316	0.66
317	0.63
318	0.58
319	0.53
320	0.53
321	0.48
322	0.44
323	0.39
324	0.39
325	0.35
326	0.3
327	0.25
328	0.18
329	0.15
330	0.12
331	0.13
332	0.16
333	0.24
334	0.26
335	0.27
336	0.32
337	0.38
338	0.4
339	0.41
340	0.4
341	0.36
342	0.42
343	0.42
344	0.41
345	0.39
346	0.36
347	0.33
348	0.3
349	0.27
350	0.2
351	0.21
352	0.25
353	0.28
354	0.28
355	0.28
356	0.29
357	0.26
358	0.25
359	0.22
360	0.14
361	0.07
362	0.07
363	0.07
364	0.06
365	0.07
366	0.07
367	0.07
368	0.08
369	0.09
370	0.11
371	0.11
372	0.11
373	0.1
374	0.1
375	0.1
376	0.09
377	0.07
378	0.05
379	0.05
380	0.05
381	0.05
382	0.09
383	0.09
384	0.1
385	0.11
386	0.18
387	0.21
388	0.3
389	0.32
390	0.31
391	0.42
392	0.44
393	0.5
394	0.48
395	0.48
396	0.4
397	0.49
398	0.54
399	0.49
400	0.5
401	0.47
402	0.47
403	0.51
404	0.58
405	0.59
406	0.59
407	0.62
408	0.69
409	0.77
410	0.8
411	0.83
412	0.8
413	0.76
414	0.74
415	0.69
416	0.62
417	0.54

A0A4Q9LGQ9

3D AlphaFold-predicted Structure Viewer