Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9LGQ9

Protein Details
Accession A0A4Q9LGQ9    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
410-430FLNLCDRFKDKKNNLSHKINLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR034085  TOG  
IPR045110  XMAP215  
Gene Ontology GO:0043232  C:intracellular non-membrane-bounded organelle  
GO:0099080  C:supramolecular complex  
GO:0061863  F:microtubule plus end polymerase  
GO:0051010  F:microtubule plus-end binding  
GO:0030951  P:establishment or maintenance of microtubule cytoskeleton polarity  
GO:0046785  P:microtubule polymerization  
GO:0007051  P:spindle organization  
Amino Acid Sequences MTEADSPTLKNLKSTDWKIRLQTYQSLQPHEISPEIIKTLTKETTVPVLEAGVSILLIYKPSYLYPHIVPLFCNLCTSKVSLKSKILEIFFYILNNLSKEVLFDLFIFLENKNPKLVCSVIVLIKDVTKQYGVIYNVEGVNLSNLLQHSDSSVRKEAMVLIIEIYKTYKERVLIYIKGVKPIILKNLEEEFLKIREMSKKEGFKDKGSKLEGVSDKGCKLEGVSDCIDKQQGVSYSTHEQQGVSNSIHKQQGVSNSIHKQHPVNNSADTYHPISDSTDIQYPVNNCTDTYHPFNNSTDTYHPLNNNIPQQHPVTETPNKQHPFNNTPNKQHPVKLDEGCYDMVKSMDWKERKMGVEEIYKYLKSGGVNEGKVVGVLSKMVSDINIQVLLTVLDTLLLLEKRDFQSRKDFFLNLCDRFKDKKNNLSHKINLVLERAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.55
4 0.61
5 0.63
6 0.67
7 0.66
8 0.61
9 0.62
10 0.56
11 0.59
12 0.58
13 0.58
14 0.53
15 0.48
16 0.46
17 0.4
18 0.35
19 0.28
20 0.25
21 0.21
22 0.21
23 0.19
24 0.18
25 0.18
26 0.22
27 0.22
28 0.21
29 0.2
30 0.21
31 0.27
32 0.27
33 0.25
34 0.19
35 0.18
36 0.17
37 0.16
38 0.14
39 0.07
40 0.06
41 0.05
42 0.06
43 0.05
44 0.06
45 0.06
46 0.07
47 0.08
48 0.09
49 0.13
50 0.15
51 0.18
52 0.19
53 0.27
54 0.3
55 0.29
56 0.29
57 0.31
58 0.31
59 0.27
60 0.29
61 0.22
62 0.2
63 0.21
64 0.24
65 0.25
66 0.31
67 0.37
68 0.39
69 0.43
70 0.44
71 0.48
72 0.5
73 0.45
74 0.36
75 0.33
76 0.29
77 0.24
78 0.22
79 0.17
80 0.15
81 0.15
82 0.15
83 0.14
84 0.12
85 0.12
86 0.12
87 0.13
88 0.11
89 0.1
90 0.1
91 0.1
92 0.09
93 0.11
94 0.12
95 0.1
96 0.17
97 0.19
98 0.19
99 0.21
100 0.21
101 0.2
102 0.22
103 0.23
104 0.17
105 0.18
106 0.2
107 0.19
108 0.19
109 0.2
110 0.17
111 0.17
112 0.17
113 0.15
114 0.13
115 0.11
116 0.11
117 0.11
118 0.16
119 0.16
120 0.15
121 0.16
122 0.17
123 0.16
124 0.16
125 0.15
126 0.09
127 0.08
128 0.08
129 0.07
130 0.07
131 0.07
132 0.08
133 0.08
134 0.08
135 0.1
136 0.14
137 0.16
138 0.18
139 0.21
140 0.2
141 0.2
142 0.2
143 0.19
144 0.16
145 0.16
146 0.12
147 0.1
148 0.1
149 0.1
150 0.1
151 0.09
152 0.08
153 0.08
154 0.09
155 0.1
156 0.11
157 0.13
158 0.18
159 0.22
160 0.23
161 0.26
162 0.32
163 0.31
164 0.32
165 0.31
166 0.27
167 0.25
168 0.25
169 0.27
170 0.22
171 0.22
172 0.21
173 0.23
174 0.22
175 0.2
176 0.19
177 0.15
178 0.13
179 0.13
180 0.11
181 0.12
182 0.17
183 0.19
184 0.24
185 0.29
186 0.33
187 0.35
188 0.44
189 0.44
190 0.44
191 0.5
192 0.47
193 0.47
194 0.45
195 0.43
196 0.34
197 0.39
198 0.34
199 0.28
200 0.28
201 0.22
202 0.21
203 0.19
204 0.19
205 0.12
206 0.1
207 0.13
208 0.12
209 0.14
210 0.15
211 0.16
212 0.16
213 0.17
214 0.17
215 0.12
216 0.11
217 0.1
218 0.1
219 0.12
220 0.12
221 0.15
222 0.18
223 0.19
224 0.21
225 0.18
226 0.16
227 0.15
228 0.18
229 0.18
230 0.15
231 0.17
232 0.16
233 0.2
234 0.21
235 0.2
236 0.18
237 0.18
238 0.24
239 0.24
240 0.24
241 0.26
242 0.29
243 0.33
244 0.33
245 0.32
246 0.28
247 0.31
248 0.36
249 0.34
250 0.32
251 0.3
252 0.3
253 0.29
254 0.28
255 0.25
256 0.2
257 0.17
258 0.15
259 0.13
260 0.13
261 0.14
262 0.14
263 0.14
264 0.15
265 0.15
266 0.15
267 0.17
268 0.18
269 0.19
270 0.2
271 0.18
272 0.14
273 0.16
274 0.19
275 0.21
276 0.25
277 0.26
278 0.25
279 0.27
280 0.28
281 0.29
282 0.27
283 0.26
284 0.23
285 0.23
286 0.24
287 0.25
288 0.25
289 0.25
290 0.28
291 0.3
292 0.34
293 0.32
294 0.31
295 0.3
296 0.31
297 0.3
298 0.29
299 0.27
300 0.28
301 0.33
302 0.35
303 0.38
304 0.45
305 0.46
306 0.45
307 0.46
308 0.47
309 0.48
310 0.55
311 0.6
312 0.58
313 0.64
314 0.69
315 0.71
316 0.66
317 0.63
318 0.58
319 0.53
320 0.53
321 0.48
322 0.44
323 0.39
324 0.39
325 0.35
326 0.3
327 0.25
328 0.18
329 0.15
330 0.12
331 0.13
332 0.16
333 0.24
334 0.26
335 0.27
336 0.32
337 0.38
338 0.4
339 0.41
340 0.4
341 0.36
342 0.42
343 0.42
344 0.41
345 0.39
346 0.36
347 0.33
348 0.3
349 0.27
350 0.2
351 0.21
352 0.25
353 0.28
354 0.28
355 0.28
356 0.29
357 0.26
358 0.25
359 0.22
360 0.14
361 0.07
362 0.07
363 0.07
364 0.06
365 0.07
366 0.07
367 0.07
368 0.08
369 0.09
370 0.11
371 0.11
372 0.11
373 0.1
374 0.1
375 0.1
376 0.09
377 0.07
378 0.05
379 0.05
380 0.05
381 0.05
382 0.09
383 0.09
384 0.1
385 0.11
386 0.18
387 0.21
388 0.3
389 0.32
390 0.31
391 0.42
392 0.44
393 0.5
394 0.48
395 0.48
396 0.4
397 0.49
398 0.54
399 0.49
400 0.5
401 0.47
402 0.47
403 0.51
404 0.58
405 0.59
406 0.59
407 0.62
408 0.69
409 0.77
410 0.8
411 0.83
412 0.8
413 0.76
414 0.74
415 0.69
416 0.62
417 0.54